KEGG   Bacillus subtilis subsp. subtilis 168: BSU07360
Entry
BSU07360          CDS       T00010                                 

Symbol
yfmS
Name
(RefSeq) sensory transducer protein YfmS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MCPsignal DUF948 Laminin_II DUF1664 NPV_P10 Mce4_CUP1 DUF6507 CorA DUF677 ATG17_like T7SS_ESX_EspC TMP_3 sCache_3_3 Vps5 DUF3450 ox_reductase_C CHASE3 Collagen_mid Laminin_I GIT1_C SKA1
Other DBs
NCBI-GeneID: 936102
NCBI-ProteinID: NP_388617
Pasteur: BG12970
BSORF: BG12970
UniProt: O06477 A0A6M4JDU9
Position
808562..809422
AA seq 286 aa
MELTINTEKETADILDAFIKVAPYLNSLVQDDITIGIYDTEKLLVNIPAKTFSLNVKAGD
PLQEGDIITDAIRSNQKKTSMVPKELFGFPLIARAIPLHDENGRVIGGVGLGTSLEESSK
LHDVAESLSAVVEQTAAAISDISESINGFSTQMSGISSQAKKVSESAGEIADISVTVKGI
SDQSNLLGLNAAIEAARAGESGKGFSVVADEIRKLATHSKENVGQIDQITKKIHSLLKGL
EESIESINQHTDGQAAAVEQISATMQEISGSAQHLAKMAEKALEEE
NT seq 861 nt   +upstreamnt  +downstreamnt
atggaattgaccataaatacggaaaaagaaaccgcagatattctggacgcatttatcaaa
gtagccccttatttaaacagcctggttcaggatgatattacaatcggcatttatgatacg
gaaaaactgctcgtgaatataccggccaaaaccttttcgctgaacgtaaaagccggcgat
ccgctgcaggaaggggatatcatcacagatgccatccgcagcaatcagaagaagacgagc
atggttccgaaagaattgttcggcttcccattgatcgcgcgtgccatcccgctgcacgac
gagaatggaagagtcattggaggcgtcggcctcggaacgagccttgaggagtcgtcaaag
ctgcatgatgtcgcggaaagcttatcagctgttgttgaacaaacagccgcggctatttcc
gacatttctgaatcaattaacgggttttcaactcaaatgtcgggcatttcctctcaggcg
aaaaaagtaagcgaaagcgccggtgaaatcgccgatatttcagtaactgttaaaggcatc
tcggaccaaagcaatctgctcggcttgaacgccgcgatcgaagcggcaagagcaggggag
tccggaaaaggattctctgtcgtcgcagatgagatcagaaagctagcgacgcattcaaaa
gaaaatgtcggccaaattgaccagattacgaaaaaaatccacagcctgctgaaagggctg
gaggaatccattgagtcgattaaccagcatacagacggacaagccgctgctgttgaacaa
atttccgccacgatgcaggagatttcaggaagcgcgcagcatcttgcgaaaatggccgaa
aaagcgcttgaggaagagtaa

DBGET integrated database retrieval system