KEGG   Bacillus subtilis subsp. subtilis 168: BSU07390
Entry
BSU07390          CDS       T00010                                 

Symbol
yfmP
Name
(RefSeq) MerR family transcriptional regulator
  KO
K21902  MerR family transcriptional regulator, repressor of the yfmOP operon
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU07390 (yfmP)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   MerR family
    BSU07390 (yfmP)
SSDB
Motif
Pfam: MerR_1 MerR MerR-DNA-bind HTH_17 DUF3829 ING HTH_3 PHM7_cyt DUF724
Other DBs
NCBI-GeneID: 936101
NCBI-ProteinID: NP_388620
Pasteur: BG12967
BSORF: BG12967
UniProt: O06474 A0A6M3Z8Y6
Position
812140..812562
AA seq 140 aa
MEWMKIDQVAKRSGLTKRTIRFYEEIGLIPAPKRTDGGVRLYSEDDMEELEKVISTKEVL
GFSLQELQHFMETSRQLELNKEGYLLSLDPKERKEKLEEIQETLNHQLDLIDEKIRTFQS
FKERLQGMKGKAERAIQSIE
NT seq 423 nt   +upstreamnt  +downstreamnt
ttggaatggatgaagattgatcaagtggccaaaagaagcgggctgacaaagcggaccatc
cggttttatgaagaaatcggcttgattccggcgccgaaacggacagacggcggtgtaagg
ctttattcagaggatgatatggaggagcttgagaaagtcatcagcacaaaagaggtgctc
ggtttttcccttcaggagcttcagcatttcatggaaaccagccgccagctagagttaaac
aaagaggggtatttgttgtcactggatcctaaggaacggaaagaaaaactggaggaaatt
caggaaaccctgaatcaccagctggatttgattgatgagaaaatccgcacattccaaagc
tttaaagaacgcctgcagggcatgaaaggcaaagcggaacgcgccattcaatcaatcgaa
tga

DBGET integrated database retrieval system