KEGG   Bacillus subtilis subsp. subtilis 168: BSU07420
Entry
BSU07420          CDS       T00010                                 

Symbol
yfmM
Name
(RefSeq) ABC transporter ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N RNA_helicase RsgA_GTPase MMR_HSR1 NB-ARC AAA_29 AAA AAA_16 AAA_14 AAA_28 NACHT AAA_24 AAA_22 TsaE AAA_25 TrwB_AAD_bind ATP-synt_ab DUF641 DUF4446 ADIP ATPase_2 DUF3584
Other DBs
NCBI-GeneID: 936103
NCBI-ProteinID: NP_388623
Pasteur: BG12964
BSORF: BG12964
UniProt: O34512 A0A6M4JHA0
Position
complement(814384..815940)
AA seq 518 aa
MSILSVKDLSHGFGDRAIFNNVSFRLLKGEHVGLIGANGEGKSTFMNIITGKLEPDEGKV
EWSKNVRVGYLDQHTVLEKGKSIRDVLKDAFHYLFAMEEEMNEIYNKMGEADPDELEKLL
EEVGVIQDALTNNDFYVIDSKVEEIARGLGLSDIGLERDVTDLSGGQRTKVLLAKLLLEK
PEILLLDEPTNYLDEQHIEWLKRYLQEYENAFILISHDIPFLNSVINLIYHVENQELTRY
VGDYHQFMEVYEVKKQQLEAAYKKQQQEVAELKDFVARNKARVSTRNMAMSRQKKLDKMD
MIELAAEKPKPEFHFKPARTSGKLIFETKDLVIGYDSPLSRPLNLRMERGQKIALYGANG
IGKTTLLKSLLGEIQPLEGSVERGEHIYTGYFEQEVKETNNNTCIEEVWSEFPSYTQYEI
RAALAKCGLTTKHIESRVSVLSGGEKAKVRLCKLINSETNLLVLDEPTNHLDADAKEELK
RALKEYKGSILLISHEPDFYMDIATETWNCESWTTKVL
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgagtattttatctgtaaaggatttaagccacggtttcggggaccgggccatttttaat
aacgtttccttccgcctgttaaaaggcgagcacgtcggcttgatcggcgcaaacggtgaa
ggaaaatcaaccttcatgaatattattaccggaaagcttgaacctgatgagggaaaagtc
gaatggtcaaaaaatgtccgtgtcggataccttgatcagcataccgtgctggaaaaagga
aaatccattcgcgacgtcctgaaagacgcattccattatttatttgcgatggaagaggaa
atgaacgagatttacaacaaaatgggcgaggctgatcccgacgagctcgagaagctgctt
gaagaagtcggcgtcattcaagacgcgctgacaaacaatgatttttatgtcattgattcc
aaggtggaagaaatcgcccgcggtctcggtttgagcgatatcggtttagagcgagatgtc
accgatttgagcggcggacagcgcacaaaggtccttctcgctaagcttctccttgaaaag
ccggaaattctgcttctcgatgagccgaccaactatcttgatgaacagcatattgaatgg
ctgaaacgctacctgcaggaatacgagaacgcgttcatcctgatttcccacgatattccg
ttcttgaatagtgtcatcaacctgatttatcacgttgaaaatcaagagctgacacgttat
gtcggcgactaccatcagtttatggaagtctacgaggtgaaaaaacagcagcttgaagcg
gcctacaaaaagcagcagcaggaagtcgcggagctgaaggatttcgtcgcccgcaacaaa
gcgcgtgtcagcacgagaaacatggcgatgtcccgccaaaagaaactcgataagatggat
atgatcgagcttgcggcagaaaagccaaagccggaattccactttaagccggcgagaacg
tcaggcaagctgatttttgaaacgaaggatctcgtgatcggttacgattccccgctgtcc
cgtccgctcaacctccgcatggagcgcggccaaaaaatcgccctttacggcgcgaatggg
atcggaaaaacgacattgctgaaaagtttgcttggtgaaatccagccgctcgaaggctct
gttgaacgcggtgagcacatctataccggctatttcgagcaagaggtcaaggaaacaaac
aacaatacgtgcatcgaagaagtatggagcgaattcccttcttatacgcagtatgaaatc
cgtgccgctctggcaaaatgcgggctgacgacaaagcatatcgaaagccgcgtctccgta
ttaagcggaggcgaaaaagcgaaagtcagattgtgcaagctaatcaactcagaaacaaac
ctgctggtgctcgatgagccgacaaaccacttggatgccgatgccaaggaagagctcaag
cgcgccctgaaagaatataaaggctccattctgctcatttcccacgagccagacttttat
atggatattgcgacagaaacgtggaactgcgagtcttggacgacgaaagtgctttaa

DBGET integrated database retrieval system