KEGG   Bacillus subtilis subsp. subtilis 168: BSU08010
Entry
BSU08010          CDS       T00010                                 

Symbol
yfjP
Name
(RefSeq) DNA-3-methyladenine glycosylase YfjP
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BSU08010 (yfjP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU08010 (yfjP)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     BSU08010 (yfjP)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BSU08010 (yfjP)
SSDB
Motif
Pfam: HhH-GPD HHH_5
Other DBs
NCBI-GeneID: 939192
NCBI-ProteinID: NP_388682
Pasteur: BG12912
BSORF: BG12912
UniProt: O31544 A0A6M4JE33
Position
872425..873288
AA seq 287 aa
MWKEKVSVTPPYHFDRVLDRLSLDPLNAVDREAREVRVPIRNQAGDVCIVKVQALGHAGE
PEFLVSGETDQGEMMKEIKRIFQWENHLQHVLDHFSKTSLSAIFEEHAGTPLVLDYSVYN
CMMKCIIHQQLNLSFAYTLTERFVHAFGEQKDGVWCYPKPETIAELDYQDLRDLQFSMRK
AEYTIDTSRMIAEGTLSLSELPHMADEDIMKKLIKIRGIGPWTVQNVLMFGLGRPNLFPL
ADIGLQNAIKRHFQLDDKPAKDVMLAMSKEWEPYLSYASLYLWRSIE
NT seq 864 nt   +upstreamnt  +downstreamnt
atgtggaaggaaaaagtatctgtcacgcctccgtatcattttgaccgcgtgctggacagg
ctgtctttagaccccctcaatgctgttgatcgagaggcgagggaagtccgtgtgccaatc
agaaatcaagcgggggacgtatgtattgtaaaggtacaggcgttaggccatgcgggcgag
cctgagttcctcgtcagcggggaaacggatcagggagaaatgatgaaggaaatcaagcgg
atttttcaatgggaaaatcatttgcagcacgttctggatcatttttcaaaaacgagcctg
tccgccatttttgaagagcatgccgggacgccgcttgttctggactacagcgtgtacaac
tgcatgatgaaatgcattatccaccagcagcttaatctttccttcgcttacacgctaaca
gaacggtttgttcatgcgtttggcgagcagaaggatggcgtgtggtgctatccaaagccg
gaaacgattgcggaactcgattatcaggatctgcgtgatctgcaattcagcatgagaaaa
gcggaatacaccattgatacatcaaggatgatcgcagaaggcacactcagcttgtcagag
ctgccgcatatggcggatgaagacattatgaagaaactgatcaaaatcaggggtatcggc
ccgtggaccgtgcaaaacgtcctcatgttcggacttggccgtcccaatttattcccgctt
gccgatatcggcctccagaatgccatcaaacgccactttcagctggacgataagccggca
aaggatgtcatgctggcgatgagcaaggagtgggagccttatttaagctatgcgtctttg
tatttgtggaggagtatagaataa

DBGET integrated database retrieval system