KEGG   Bacillus subtilis subsp. subtilis 168: BSU08210
Entry
BSU08210          CDS       T00010                                 

Symbol
malQ
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K18887  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU08210 (malQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08210 (malQ)
Transporters [BR:bsu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BSU08210 (malQ)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 ABC_ATPase AAA_29 DUF87 AAA_21 G-alpha T2SSE AAA_23 AAA_14 VipB
Other DBs
NCBI-GeneID: 936163
NCBI-ProteinID: NP_388702
Pasteur: BG11849
BSORF: BG11849
UniProt: P54718 A0A6M4JE55
Position
893904..895625
AA seq 573 aa
MQKALSFLKPYSLLAGIALILMLTELAVELMQPLLIAKIIDDGILKQDLRHVWIWGTVMI
GLTVLSFAAGMLNSFYAAHVSQSFSYDTRKGLFQKIQSFSYSTFGQFSSSSYITRLTNDV
TQVQNMIFMSLRFMLRAPLMIAGGIVLSLAVNVKLGFFLLVTIPILILFLLWVLRKGGAL
FRSVQKRLDQVNTIMQENLIAIKLIKALLRGSHEVKRFIKANTRLMEKTVSAFQLVEFTM
PVLMLLMNLCILLILWAGSYSITSGSTQVGDVVAIINYATRITGALSMFPFLIMIFTRAK
ASGDRIGEVLETEGDEREEGTISDRLSGRIEFQHVSFRYPEMDREALRNVSFSAKPRETI
AILGATGSGKSTLFQLIPRLYQPDSGRIYIDEKPVQDIPAEGLRRQIGYVPQEVLLFSGT
IKENIAWGKENASLDEIMDAAKLAQIHETILKLPNGYDTVLGQRGVNLSGGQKQRISIAR
ALIRKPAILLLDDSTSALDLQTEAKLLEAISTYHCTTLIITQKITTAMKADQILLLEDGE
LIEKGTHSELLSESQLYKRIYESQFGREGSESC
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgcaaaaggctttgtcgtttttaaaaccatattcattgctggcgggaattgctctgatt
cttatgctgacggagcttgcagttgaactgatgcagcctttattgattgcaaaaatcatc
gacgatgggatattgaagcaagatctgcggcatgtatggatatggggcacggtcatgatc
gggctgaccgtgttatcctttgcggcggggatgctgaattccttttatgccgcccatgtc
agccaaagcttttcctatgatacgagaaaagggctttttcaaaaaatccagtccttctcc
tattccacatttggacagttttcgtcctcttcttatattacaaggctgacaaacgacgtc
acacaggttcaaaatatgatttttatgagtttgcggtttatgctgcgggctcccttaatg
attgcaggcggcattgtgctgtcgcttgccgttaatgtgaaactcgggttttttctgctt
gtgaccattccgatcctgatcttgtttttgctatgggtattaaggaaaggcggggcactg
ttccgctcagtgcagaaaaggctggatcaagtgaacaccatcatgcaggaaaatttaatt
gcaatcaagctgatcaaagcgctgcttcgcggcagccacgaagtcaaacgatttatcaaa
gccaacacaaggctgatggaaaaaacggtttcggcctttcagcttgtggaattcacgatg
cctgtactgatgctgctgatgaatctctgcatccttttgattttgtgggcggggtcctac
agtattacgagcggaagcactcaggttggcgatgttgttgcgataattaactacgcaaca
cgaattacaggcgcgctttcgatgtttccgtttttgattatgattttcacccgggcgaag
gcttcaggggatagaatcggtgaggtgcttgaaacagaaggcgacgagcgggaggaaggc
accatatctgatcgtttgtcaggacggattgagtttcagcatgtatcctttcgctatcct
gaaatggacagagaagcgctcaggaatgtctcattttccgcaaagccaagagaaacgatc
gcgattctcggtgcgacgggctcgggcaagtccacgctttttcagctcattccgcggctt
tatcagccggattcaggccgcatttacatagatgaaaagccggttcaagatattccggct
gaagggctgcgcaggcaaattggatatgtaccgcaggaagtcctcttgttttccggcaca
atcaaagaaaacatcgcttggggcaaagaaaatgcttcactagatgaaataatggatgcg
gcaaaacttgcgcaaattcatgaaacgattttaaagctcccaaatggatatgacactgtt
ttggggcaaagaggcgtcaacctgtccggcggccaaaagcagcggatttccattgcgcgg
gcgctgattcgaaaaccggctatccttctattagatgacagcacaagcgcgcttgatctg
caaacggaggcgaagctgcttgaagcaatcagcacataccattgcacaactttgatcatt
acacaaaaaataaccacggcgatgaaagctgatcagattttgctgcttgaggacggcgaa
ctgattgaaaaaggcactcacagtgagctgctttctgaatctcagttatacaagcgcatt
tacgagtcacaattcggaagggaggggagcgagtcatgctaa

DBGET integrated database retrieval system