KEGG   Bacillus subtilis subsp. subtilis 168: BSU08370
Entry
BSU08370          CDS       T00010                                 

Symbol
yfiR
Name
(RefSeq) TetR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TetR_C_17 TetR_N TetR_C_27 TetR_C_24 TetR_C_6 SYCP2_ARLD TetR_C_29
Other DBs
NCBI-GeneID: 936176
NCBI-ProteinID: NP_388718
Pasteur: BG12894
BSORF: BG12894
UniProt: O31560 A0A6M3Z935
Structure
Position
complement(911964..912581)
AA seq 205 aa
MSPKVTKEHKDKRQAEILEAAKTVFKRKGFELTTMKDVVEESGFSRGGVYLYFSSTEEMF
RRIIETGLDEGLRKLDKSAEHQSVWASISSYLDELTEGLRDVADTLAPVQFEYLVTAWRN
EERRQYLEKRYDLFVERFSRLLQKGIDQGEFQPVQPLATIAKFFLNMNDGIIQNALYFDE
EKADVSGLAESAKLYLKTVLQADEK
NT seq 618 nt   +upstreamnt  +downstreamnt
ttgtcaccaaaagtaacaaaggagcacaaggataaacggcaggcagagattttagaggct
gccaaaacggtttttaaacgaaaaggattcgaattaacgacgatgaaggatgttgtagaa
gagtcaggtttcagccggggcggtgtctatctttatttttcaagcactgaggagatgttt
cgccgcattattgaaacagggctggatgaaggactccgaaagcttgataaatcagctgaa
caccaaagtgtttgggcctccatttccagctatttggatgaactgactgagggcctgcga
gatgtagcagatacgctggcgccggtgcaatttgaatatttagtgacagcttggcgcaat
gaagaacggcggcagtatttggagaaaaggtatgatctttttgtggaaaggttttcaagg
ctattgcaaaaagggatcgatcagggagagtttcagccggttcagcctcttgcgactatc
gccaagtttttcctcaatatgaatgacggcatcattcaaaacgccctgtatttcgatgaa
gaaaaggctgatgtatctggacttgctgagtctgcaaaactatatttaaaaacagttctg
caagcggatgagaagtaa

DBGET integrated database retrieval system