KEGG   Bacillus subtilis subsp. subtilis 168: BSU08470
Entry
BSU08470          CDS       T00010                                 

Symbol
yfhB
Name
(RefSeq) isomerase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PhzC-PhzF DAP_epimerase Pro_racemase DUF6229
Other DBs
NCBI-GeneID: 936191
NCBI-ProteinID: NP_388728
Pasteur: BG12877
BSORF: BG12877
UniProt: O31570 A0A6M4JHK3
Position
922618..923499
AA seq 293 aa
MKEAEVLKYEAFTSSPGKGNPAGVVLQGDDYTEDEMQIIAERAGYSETSFIRKSESADLE
LRYFTPGHEMNLCGHATVASLYALCEKGMLESGKTYSIQTKAGILPVKISEKDGRIHITL
EQASPQFKPFTGDRKKLADALGITDEDFHEDLPIVFGSTGIWTAIVPLKSLEASKKMVPD
NKQFPEVLVDLPKASVHPFTFETVHPDSDLHGRHFSSPYSGTIEDPVTGTASGVMGAYMK
HYGNAEQHKFIIEQGQEIGKDGKVEIEMNEAGGHVKVNMTGTAVYSETRILKI
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaaagaagcagaggtattaaaatatgaagcatttacaagcagtcccggcaaaggaaac
cccgcaggcgtcgttttgcagggagacgattatacggaagacgagatgcagatcatagct
gaacgtgccgggtattcagaaacctcctttatccgaaaaagcgagtcggccgatcttgaa
ctccgttactttacccctggacacgaaatgaatttgtgcggtcatgcgacagttgcttct
ctttacgcattatgtgagaaaggaatgctggagagcggtaaaacgtacagcatccaaacg
aaagcgggtatcctgcctgtgaagatttctgaaaaagatggccgcattcatatcacgctt
gaacaggcctctccgcaattcaaaccatttacaggcgatcggaaaaaacttgcggacgca
ctgggtatcaccgatgaagattttcatgaagaccttccgattgtgtttggcagcactggg
atatggacagccatcgttccgcttaaatcattggaggcttccaaaaaaatggtgccagat
aacaaacaatttccggaagtgttagttgatctgccaaaagcttcagtccatccgtttacc
tttgaaaccgtccatcccgacagcgacctgcacgggcgccacttttcatccccgtattcg
ggaacgattgaagaccccgtgaccggcacagcatccggcgtgatgggggcttatatgaaa
cattatggcaatgccgagcagcataaatttatcattgaacaagggcaggaaattggaaaa
gacggaaaagtggagatcgaaatgaacgaagccggcggccatgtgaaagtgaacatgaca
ggaacagccgtttactcagaaacccgtattcttaaaatctaa

DBGET integrated database retrieval system