KEGG   Bacillus subtilis subsp. subtilis 168: BSU08899
Entry
BSU08899          CDS       T00010                                 

Symbol
ygzD
Name
(RefSeq) XRE family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_26 Sigma70_r4 HTH_23 HTH_Crp_2 HTH_25
Other DBs
NCBI-GeneID: 8303098
NCBI-ProteinID: YP_003097697
UniProt: C0H3X9 A0A6M3ZIU8
Position
complement(966671..966871)
AA seq 66 aa
MKNKVKELRARFGYSQEKLGETVGVTRQTVAAIEKGDYVPSLLLALKICKAFSMKMEDVF
WLEEEN
NT seq 201 nt   +upstreamnt  +downstreamnt
atgaaaaataaagtaaaagagctgagggcacgcttcggctattctcaggaaaaactcgga
gaaacggtcggcgtcacaagacagactgtggcagcgattgaaaaaggcgattatgttccc
tcactgctgttagcactgaaaatctgcaaagccttctccatgaaaatggaggatgtcttt
tggttagaggaggaaaactaa

DBGET integrated database retrieval system