KEGG   Bacillus subtilis subsp. subtilis 168: BSU09270
Entry
BSU09270          CDS       T00010                                 

Symbol
glpP
Name
(RefSeq) glycerol uptake operon antiterminator regulatory protein
  KO
K02443  glycerol uptake operon antiterminator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU09270 (glpP)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSU09270 (glpP)
SSDB
Motif
Pfam: G3P_antiterm His_biosynth NMO FMN_dh IMPDH
Other DBs
NCBI-GeneID: 936251
NCBI-ProteinID: NP_388808
Pasteur: BG10185
BSORF: BG10185
UniProt: P30300 A0A6M4JEG1
Position
1001744..1002322
AA seq 192 aa
MMSFHNQPILPAIRNMKQFDEFLNSSFSYGVILDIHLGQLKGVIKEAQKHGKNMMVHVDL
IQGIKHDEYGAEFICQDIKPAGIISTRSNVIAKAKQKKIYAIQRLFLLDTSAMEKSMEFI
GKHKPDFIEVLPGIVPSLIQEIKEKTGIPIFAGGFIRTEEDVEQALKAGAVAVTTSNTKL
WKKYENFLTESD
NT seq 579 nt   +upstreamnt  +downstreamnt
atgatgagttttcacaaccagccgatcttaccggctattcgcaatatgaagcaatttgat
gagtttttgaacagttcattctcttacggtgttattcttgatattcatctcggccagctg
aagggcgtgatcaaagaagcgcaaaagcacggaaagaacatgatggtgcacgtcgatctc
attcaagggattaagcatgacgaatacggtgcggaatttatatgtcaggatatcaagccc
gctgggattatttccacaagatcgaatgtgattgccaaagcgaagcagaagaaaatttat
gccattcagcgcctgtttttgcttgatacaagcgcgatggagaaaagcatggagtttatc
ggcaagcataagcctgacttcatcgaagtgcttcccggcatcgttccgtcactcattcag
gaaataaaagagaaaacagggattcccatctttgccgggggtttcatccgtacggaagag
gatgtagagcaggcattgaaagcgggggctgtagctgtcacaacatctaataccaaattg
tggaaaaaatatgaaaactttttgacggaaagtgattga

DBGET integrated database retrieval system