KEGG   Bacillus subtilis subsp. subtilis 168: BSU09340Help
Entry
BSU09340          CDS       T00010                                 

Gene name
yhdA
Definition
(RefSeq) FMN-dependent NADPH-azoreductase
  KO
K03206  azobenzene reductase [EC:1.7.1.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU09340 (yhdA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.6  azobenzene reductase
     BSU09340 (yhdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2 Flavodoxin_5
Motif
Other DBs
NCBI-GeneID: 936266
NCBI-ProteinID: NP_388815
Pasteur: BG13007
BSORF: BG13007
UniProt: O07529
Structure
PDB: 

Position
1010445..1010969
Genome map
AA seq 174 aa AA seqDB search
MNMLVINGTPRKHGRTRIAASYIAALYHTDLIDLSEFVLPVFNGEAEQSELLKVQELKQR
VTKADAIVLLSPEYHSGMSGALKNALDFLSSEQFKYKPVALLAVAGGGKGGINALNNMRT
VMRGVYANVIPKQLVLDPVHIDVENATVAENIKESIKELVEELSMFAKAGNPGV
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgttagtcataaatggcacgccaagaaaacatggcagaacaagaattgcagca
tcctatattgcagctctgtatcacacggatttgattgatctaagcgagtttgtattgccc
gtttttaacggtgaagcggaacaatctgaactgttgaaagtacaggagcttaagcaacgc
gttacgaaagcggatgcgattgtattattatcgcctgaatatcacagcggcatgagcggc
gctttaaaaaatgccttggattttctaagcagcgaacaattcaaatataagcccgttgca
ttattggcagtagcgggaggcggaaaaggcggcatcaatgcgctgaacaatatgagaact
gtgatgcggggtgtctacgccaatgtcattccgaagcagctggtgcttgatccggtgcat
attgatgttgaaaatgctacagtggctgaaaacattaaggaaagcataaaagagcttgtc
gaagaactcagcatgttcgcaaaagcaggaaatcccggcgtctaa

DBGET integrated database retrieval system