KEGG   Bacillus subtilis subsp. subtilis 168: BSU10000
Entry
BSU10000          CDS       T00010                                 

Symbol
yhaH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YtxH ApoLp-III WXG100 Fzo_mitofusin Lectin_N OmpH FapA Fib_alpha ATG17_like SF-assemblin THOC7 Phage_GP20 phiKZ_IP TMPIT Syntaxin-6_N DUF5082 Baculo_PEP_C Streptin-Immun FliD_C DUF1043 Prefoldin_2 DUF6674 bZIP_2 DUF465 ADIP Relaxase ACCA Laminin_II Metal_resist BLOC1_2 Helo_like_N PI_PP_I GAS Tektin Prominin DUF948 EF-G-binding_N CLZ DUF4164 DUF1993 DivIVA UPF0242 DUF1664 Cnn_1N Mei5 CdvA KxDL Spore_III_AB VAPB_antitox DUF4200 DUF4407
Other DBs
NCBI-GeneID: 936291
NCBI-ProteinID: NP_388881
Pasteur: BG12984
BSORF: BG12984
UniProt: O07516 A0A6M4JK40
Position
complement(1073895..1074251)
AA seq 118 aa
MASGRSLLTGLFVGGIIGGAAVLLTAPSSGKQLREKMKTNYDSFEETIKRLKSDGLALKD
QLIKAAKESTDVIKDVGGELQTSIKKWQEEIKPHQQDLQKEIADIEEKIRQLEKTLQN
NT seq 357 nt   +upstreamnt  +downstreamnt
atggcgagcggacgttctctattaacaggactattcgtaggcggcatcatcggaggagca
gcggttcttcttactgcaccttcctcaggaaagcagctgcgtgaaaaaatgaaaaccaat
tatgattcttttgaagaaacaatcaaacgcttaaagtcagacgggcttgcattaaaagac
cagctgatcaaagcggcaaaagaaagcacggatgttattaaagacgtgggcggcgagctc
caaacatcaattaaaaaatggcaggaagagatcaagcctcaccagcaggatctgcaaaaa
gaaattgccgatatcgaagagaaaatcagacagctggagaaaaccttacaaaactaa

DBGET integrated database retrieval system