KEGG   Bacillus subtilis subsp. subtilis 168: BSU10300
Entry
BSU10300          CDS       T00010                                 

Symbol
aprE
Name
(RefSeq) subtilisin E
  KO
K01342  subtilisin [EC:3.4.21.62]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU10300 (aprE)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU10300 (aprE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     BSU10300 (aprE)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S8: subtilisin family
   BSU10300 (aprE)
Chaperones and folding catalysts [BR:bsu03110]
 Intramolecular chaperones
  Subtilisin family
   BSU10300 (aprE)
SSDB
Motif
Pfam: Peptidase_S8 Inhibitor_I9
Other DBs
NCBI-GeneID: 939313
NCBI-ProteinID: NP_388911
Pasteur: BG10190
BSORF: BG10190
UniProt: P04189 A0A6M4JK64
Structure
Position
complement(1104423..1105568)
AA seq 381 aa
MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKSSTEKKYIVGFKQTMSAMSSAKKKDVIS
EKGGKVQKQFKYVNAAAATLDEKAVKELKKDPSVAYVEEDHIAHEYAQSVPYGISQIKAP
ALHSQGYTGSNVKVAVIDSGIDSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAGTIAA
LNNSIGVLGVAPSASLYAVKVLDSTGSGQYSWIINGIEWAISNNMDVINMSLGGPTGSTA
LKTVVDKAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGS
ELDVMAPGVSIQSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTA
TYLGNSFYYGKGLINVQAAAQ
NT seq 1146 nt   +upstreamnt  +downstreamnt
gtgagaagcaaaaaattgtggatcagcttgttgtttgcgttaacgttaatctttacgatg
gcgttcagcaacatgtctgcgcaggctgccggaaaaagcagtacagaaaagaaatacatt
gtcggatttaaacagacaatgagtgccatgagttccgccaagaaaaaggatgttatttct
gaaaaaggcggaaaggttcaaaagcaatttaagtatgttaacgcggccgcagcaacattg
gatgaaaaagctgtaaaagaattgaaaaaagatccgagcgttgcatatgtggaagaagat
catattgcacatgaatatgcgcaatctgttccttatggcatttctcaaattaaagcgccg
gctcttcactctcaaggctacacaggctctaacgtaaaagtagctgttatcgacagcgga
attgactcttctcatcctgacttaaacgtcagaggcggagcaagcttcgtaccttctgaa
acaaacccataccaggacggcagttctcacggtacgcatgtagccggtacgattgccgct
cttaataactcaatcggtgttctgggcgtagcgccaagcgcatcattatatgcagtaaaa
gtgcttgattcaacaggaagcggccaatatagctggattattaacggcattgagtgggcc
atttccaacaatatggatgttatcaacatgagccttggcggacctactggttctacagcg
ctgaaaacagtcgttgacaaagccgtttccagcggtatcgtcgttgctgccgcagccgga
aacgaaggttcatccggaagcacaagcacagtcggctaccctgcaaaatatccttctact
attgcagtaggtgcggtaaacagcagcaaccaaagagcttcattctccagcgcaggttct
gagcttgatgtgatggctcctggcgtgtccatccaaagcacacttcctggaggcacttac
ggcgcttataacggaacgtccatggcgactcctcacgttgccggagcagcagcgttaatt
ctttctaagcacccgacttggacaaacgcgcaagtccgtgatcgtttagaaagcactgca
acatatcttggaaactctttctactatggaaaagggttaatcaacgtacaagcagctgca
caataa

DBGET integrated database retrieval system