KEGG   Bacillus subtilis subsp. subtilis 168: BSU10480
Entry
BSU10480          CDS       T00010                                 

Symbol
yhjE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SNARE_assoc
Other DBs
NCBI-GeneID: 936333
NCBI-ProteinID: NP_388929
Pasteur: BG13072
BSORF: BG13072
UniProt: O07559 A0A6M3Z9J4
Position
1121550..1122173
AA seq 207 aa
MLEHFLSYLTQEHLTELFQSYRAFGPLIAVLLPLIEAFLPFLPLIVFVVANTNSFGLWEG
FILSWAGSTAGSILVFLIVRQYGQRKLLGFIRSHPSVRKLMLWVERHGFGPMFLLLCFPF
TPSAAVNVVAGLSRIGTRPFILAAASGKLVMIFMISFIGYDLHALITQPIRTVIAVLVIT
VLWYVGKKVERYLHVRASQREHDGGRQ
NT seq 624 nt   +upstreamnt  +downstreamnt
atgttggagcattttttatcctatttgacacaagaacatttaactgaattatttcaaagc
tatagggctttcggtccgctcattgctgtgctgctgcctttaattgaagcatttctcccg
tttttgccgctgatcgtgtttgtggtggcgaatacgaactcgtttggcttgtgggaagga
ttcatcctatcctgggcgggatcaactgctggttccattctcgtctttttgattgtccgt
caatacggacagagaaaattgcttggatttatccgcagtcatccgtctgtcagaaagctg
atgttatgggtggaaagacacggcttcggtcccatgtttcttctgctttgttttccattt
acaccgtcagccgcggtgaatgttgttgccggtttgtcaaggatcggaacgcggccgttt
attttggcggcagcctcggggaagcttgtcatgatttttatgatcagcttcatcggatat
gatctgcacgcgctgattacacagccgattcgaacggtcatcgccgtattggtgatcact
gtcttatggtatgtcggcaaaaaggtggagcggtatctgcatgtaagagccagtcagcgt
gagcatgatggagggagacagtaa

DBGET integrated database retrieval system