KEGG   Bacillus subtilis subsp. subtilis 168: BSU10630
Entry
BSU10630          CDS       T00010                                 

Symbol
addA
Name
(RefSeq) ATP-dependent helicase/nuclease subunit A
  KO
K16898  ATP-dependent helicase/nuclease subunit A [EC:3.1.-.- 3.6.4.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU10630 (addA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU10630 (addA)
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BSU10630 (addA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    AddAB pathway proteins
     BSU10630 (addA)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_12 DEAD AAA_30
Other DBs
NCBI-GeneID: 939793
NCBI-ProteinID: NP_388944
Pasteur: BG10466
BSORF: BG10466
UniProt: P23478
Structure
PDB: 
4CEI 3U4Q 4CEJ 3U44 4CEH

Position
1139807..1143505
AA seq 1232 aa
MNIPKPADSTWTDDQWNAIVSTGQDILVAAAAGSGKTAVLVERMIRKITAEENPIDVDRL
LVVTFTNASAAEMKHRIAEALEKELVQRPGSLHIRRQLSLLNRASISTLHSFCLQVLKKY
YYLIDLDPGFRIADQTEGELIGDEVLDELFEDEYAKGEKAFFELVDRYTTDRHDLDLQFL
VKQVYEYSRSHPNPEAWLESFVHLYDVSEKSAIEELPFYQYVKEDIAMVLNGAKEKLLRA
LELTKAPGGPAPRADNFLDDLAQIDELIQHQDDFSELYKRVPAVSFKRAKAVKGDEFDPA
LLDEATDLRNGAKKLLEKLKTDYFTRSPEQHLKSLAEMKPVIETLVQLVISYGKRFEAAK
QEKSIIDFSDLEHYCLAILTAENDKGEREPSEAARFYQEQFHEVLVDEYQDTNLVQESIL
QLVTSGPEETGNLFMVGDVKQSIYRFRLAEPLLFLSKYKRFTESGEGTGRKIDLNKNFRS
RADILDSTNFLFKQLMGGKIGEVDYDEQAELKLGAAYPDNDETETELLLIDNAEDTDASE
EAEELETVQFEAKAIAKEIRKLISSPFKVYDGKKKTHRNIQYRDIVILLRSMPWAPQIME
ELRAQGIPVYANLTSGYFEAVEVAVALSVLKVIDNPYQDIPLASVLRSPIVGADENELSL
IRLENKKAPYYEAMKDYLAAGDRSDELYQKLNTFYGHLQKWRAFSKNHSVSELIWEVYRD
TKYMDYVGGMPGGKQRQANLRVLYDRARQYESTAFRGLFRFLRFIERMQERGDDLGTARA
LSEQEDVVRLMTIHSSKGLEFPVVFVAGLGRNFNMMDLNKSYLLDKELGFGTKYIHPQLR
ISYPTLPLIAMKKKMRRELLSEELRVLYVALTRAKEKLFLIGSCKDHQKQLAKWQASASQ
TDWLLPEFDRYQARTYLDFIGPALARHRDLGDLAGVPAHADISGHPARFAVQMIHSYDLL
DDDLEERMEEKSERLEAIRRGEPVPGSFAFDEKAREQLSWTYPHQEVTQIRTKQSVSEIK
RKREYEDEYSGRAPVKPADGSILYRRPAFMMKKGLTAAEKGTAMHTVMQHIPLSHVPSIE
EAEQTVHRLYEKELLTEEQKDAIDIEEIVQFFHTEIGGQLIGAKWKDREIPFSLALPAKE
IYPDAHEADEPLLVQGIIDCLYETEDGLYLLDYKSDRIEGKFQHGFEGAAPILKKRYETQ
IQLYTKAVEQIAKTKVKGCALYFFDGGHILTL
NT seq 3699 nt   +upstreamnt  +downstreamnt
atgaacattcctaaaccggcagacagcacatggacagatgaccaatggaatgccattgtt
tcaaccggccaggatattcttgtggcagcggctgcgggctctggtaaaaccgctgtgctc
gttgaacgaatgattcggaaaatcaccgcggaggaaaacccaatagatgtagaccgtctt
ctcgttgtgacatttacaaacgcctcagcggcagagatgaagcaccgaatcgcagaagcc
ttggaaaaagagcttgtacagcgccccggctcgctgcatattagacgccagctgtctctt
ttaaaccgggccagcatttcgacgctccattccttttgcctgcaagtgctgaagaaatat
tactacttgatcgatcttgatccgggctttcggatagctgatcagacggaaggcgagctg
atcggggatgaagtgcttgacgagctgtttgaagacgaatacgcaaagggcgaaaaggcg
ttttttgagcttgttgaccgctatacgacagaccggcatgatctggatctgcaatttctc
gttaaacaggtgtacgagtattcccgatcccatcccaacccggaggcgtggctggaaagc
tttgttcatttgtatgatgtatcagaaaagagcgccatcgaggagctgccgttttatcaa
tatgtcaaagaagatattgcaatggtgcttaacggggcgaaggaaaagctcttgcgcgcg
cttgagctgacgaaagcgccgggcggcccggcgccgcgtgctgacaattttcttgatgat
cttgctcagattgatgaactgattcagcatcaggacgatttcagtgaactatataagcgg
gtgcccgccgtctcttttaagcgtgccaaagcagtaaaaggggatgagttcgatccagcg
ctccttgatgaggcgacagatttgaggaacggcgcaaaaaaactgcttgaaaagctcaaa
accgactacttcacgcgaagtcctgaacagcacttgaaaagcctagccgagatgaagcct
gtcattgaaacgctcgtacagcttgtcatcagctatggaaaacgattcgaagctgcgaaa
caggaaaaatcaatcatcgatttttcggatttggagcattactgtttagcgattttgaca
gctgagaatgacaaaggtgaacgtgagccgagcgaggctgcaaggttttatcaggaacag
tttcatgaggtgctcgttgacgaatatcaggataccaacctcgtgcaggaatcgattctg
cagctcgtcacaagcggtccggaggagactggtaacctgtttatggtaggagatgtcaaa
cagtcgatttatcgattcaggcttgcggagccgcttcttttcctctctaaatacaaacgg
tttacagagagcggagaaggcacggggcggaaaatcgatttaaataaaaatttccgaagc
cgggctgatattttagacagcacaaactttttatttaaacagctgatgggcggcaaaatc
ggtgaggtcgattatgacgagcaggctgagctgaagcttggtgcagcgtatccggacaat
gacgagacggaaacagagctgctgctgatcgacaacgcagaagatacggatgcaagcgag
gaagcagaagagcttgaaacggtgcagtttgaggcaaaagccatcgctaaggaaattcgt
aagctgatttcatcgccgtttaaggtgtatgacggaaaaaagaaaacacatcgcaatatt
caataccgagatatcgtgattttgctccgttcgatgccgtgggctccgcaaatcatggag
gagctgagagcacagggcataccggtttacgccaatttaacgtcaggctattttgaagcg
gtcgaagtcgccgtcgcgctttctgtgctgaaggtgattgataatccgtatcaggatata
ccgcttgcctctgtgctgcgctcaccgattgtcggagcagatgaaaacgagctgtctttg
atccggcttgaaaataaaaaagcgccgtactatgaggcgatgaaagactacctggctgct
ggtgaccggagcgatgagctttatcaaaagttaaatacgttttacggacatctgcaaaaa
tggcgcgcgttttcgaaaaaccactcagtatctgagctgatttgggaagtgtaccgcgac
accaaatatatggattatgtcggcggcatgccgggcggaaaacagcgccaggccaatttg
cgtgttctttatgacagggcgcgtcaatatgaatcaacggcatttcgcggcttgttccgt
ttcctgcggtttatcgaacgcatgcaggagcggggcgatgatcttggtacggcgagagcg
ctcagcgagcaggaggatgttgtccgcttaatgacgatccacagcagcaaagggctcgaa
tttccagtcgtgtttgtagcaggtctcggccggaatttcaacatgatggatttgaacaaa
tcgtacctgctggataaggagctcggatttggcacgaagtatattcatccgcaattacgc
atcagctatccgacacttccgctcattgcgatgaagaaaaaaatgcgcagggagctgctg
tcagaggaattgcgtgtgctctatgttgcattaacgagagcgaaggaaaagctgtttctg
attggctcatgtaaggatcatcagaaacagcttgcaaaatggcaggcatccgcgtcccaa
actgattggcttctgccggaatttgaccgctatcaggcgagaacgtatctagatttcatt
gggccggctcttgccaggcacagagacttgggggatttggctggtgtgccagcacacgct
gacatctcaggtcacccggctcgttttgccgttcaaatgatccattcctatgatttgctt
gatgatgatctggaagaaagaatggaagaaaaaagcgagcgcctagaagcgatccgccga
ggtgaaccagttcccggctcgtttgcgtttgatgaaaaagcccgcgagcagctgagctgg
acctacccgcatcaagaagtgacgcaaattcggacaaagcaatcagtttctgagatcaag
agaaaaagagagtacgaggatgaatacagcggcagggcccctgtaaaaccggctgatgga
agcattctgtacagacgtcccgcttttatgatgaaaaaaggcctgacagcggcagagaaa
gggactgccatgcatacggttatgcagcatatcccgctgtcacatgtgccgtcgatagaa
gaagctgagcagacggttcacaggctttatgaaaaagagcttctcactgaagaacaaaaa
gacgctattgatatagaagaaatcgtgcaatttttccatacagaaatcggcggacagctg
atcggtgctaagtggaaggaccgggaaataccattcagcttagcgcttccggccaaggag
atctatcctgatgcacacgaggcagatgagccgcttttagtgcagggtattattgactgt
ctctatgaaactgaggacggattatatctattggattataagtcggaccggattgagggc
aaattccagcatggatttgaaggagcggccccgatcttgaagaaacgatatgaaacgcaa
attcagctgtacacgaaggcagtggagcaaattgcaaaaacaaaggtaaagggatgtgcg
ctttatttctttgacggagggcacattctgacattatag

DBGET integrated database retrieval system