KEGG   Bacillus subtilis subsp. subtilis 168: BSU10700
Entry
BSU10700          CDS       T00010                                 

Symbol
gerPC
Name
(RefSeq) spore germination protein GerPC
  KO
K06301  spore germination protein PC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU10700 (gerPC)
SSDB
Motif
Pfam: GerPC Rx_N Prominin DUF948 Neuralized DUF2937 SlyX GlutR_dimer Fib_alpha Peptidase_M16 FliD_C Rho_Binding RPN7 Baculo_PEP_C BAR RNase_HII DUF1002
Other DBs
NCBI-GeneID: 939327
NCBI-ProteinID: NP_388951
Pasteur: BG13093
BSORF: BG13093
UniProt: O06719 A0A6M4JF20
Position
complement(1149318..1149935)
AA seq 205 aa
MYDQSVSSYLQNLNSFVQQQAIHIQQLERQLKEIQTEMNTMKQRPATTIERVEYKFDQLK
IERLDGTLNIGLNPTDPNSVQNFDVSQSTPQIGMMQQEESAQLMQQIRQNVDMYLTEEIP
DILEQLENQYDSRLDDTNRHHVIEDIRKQMDSRIHYYMSHIKKEENTPPAQYAEHIAEHV
KRDVIRAVEHFLEHIPSEMKGDEQA
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtatgatcaatctgtttcctcttacctgcaaaacttgaattccttcgttcagcagcag
gcgattcacattcagcagctcgaacgtcagctgaaagagattcaaactgaaatgaatacg
atgaaacagcggccggccactaccattgagcgtgtggagtataaatttgatcagctgaaa
atcgaaaggctcgacgggactttgaatatcggtttaaatccgactgacccgaacagcgtc
caaaactttgacgtcagccagtcgacaccgcaaatcgggatgatgcagcaggaagagagc
gctcagctcatgcagcagatccgccagaatgtcgacatgtacttaaccgaggaaatccca
gatattttggaacagcttgaaaatcaatatgacagcagacttgacgatacaaacagacat
catgttattgaagacatcagaaaacaaatggacagcaggattcactattatatgtcccat
atcaaaaaagaagaaaatacaccgcctgcacaatatgcagaacatatcgctgagcatgtg
aagcgtgatgtcatccgcgctgtagaacactttctggagcatattccatcagaaatgaaa
ggagatgagcaagcatga

DBGET integrated database retrieval system