KEGG   Bacillus subtilis subsp. subtilis 168: BSU10840
Entry
BSU10840          CDS       T00010                                 

Symbol
degA
Name
(RefSeq) LacI family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 DUF2325
Other DBs
NCBI-GeneID: 936363
NCBI-ProteinID: NP_388964
Pasteur: BG10847
BSORF: BG10847
UniProt: P37947 A0A6M4JEQ6
Position
1163148..1164161
AA seq 337 aa
MKTTIYDVAKAAGVSITTVSRVINNTGRISDKTRQKVMNVMNEMAYTPNVHAAALTGKRT
NMIALVAPDISNPFYGELAKSIEERADELGFQMLICSTDYDPKKETKYFSVLKQKKVDGI
IFATGIESHDSMSALEEIASEQIPIAMISQDKPLLPMDIVVIDDVRGGYEAAKHLLSLGH
TNIACIIGDGSTTGEKNRIKGFRQAMEEAGVPIDESLIIQTRFSLESGKEEAGKLLDRNA
PTAIFAFNDVLACAAIQAARIRGIKVPDDLSIIGFDNTILAEMAAPPLTTVAQPIKEMGR
SVIELLAEAIEGKRKAKQKIVLPPELVVRHSTSPLNT
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaaaacaacaatttacgatgtggcaaaggcggcgggtgtttcgatcacaactgtgtcc
cgtgtgataaacaatacggggagaatcagcgataaaacacggcagaaggtcatgaatgtc
atgaatgaaatggcatacacgcccaatgtccacgccgcggcgttaacgggaaaacgaacg
aatatgatcgctctcgtggcgcctgatatttcaaatccgttttacggcgaactggccaaa
agcattgaggaaagagcggatgagctcggttttcaaatgttgatttgcagcaccgattac
gatccgaaaaaagaaacaaagtatttttctgtgctgaaacagaaaaaggtggatggcatt
atttttgcaacagggattgaaagccatgacagtatgtctgctttggaggaaatcgccagt
gaacaaattccgattgccatgatttctcaggataagccgcttcttccgatggatattgtt
gtgatagacgacgttcgtggcggatatgaggctgccaagcatcttctgtcactcggccac
acgaacatcgcctgcattatcggagacgggtcaacgacaggcgaaaaaaatagaatcaaa
ggcttccgtcaggcgatggaggaagcgggcgtgcccattgatgaatcacttatcatccag
acgcggttttccttggaaagcggcaaggaagaagcgggaaaattgctcgacagaaatgct
ccgactgctatttttgccttcaacgacgtattggcttgtgccgccatacaagctgcgaga
ataagaggcataaaagtgccggatgatctttctatcattggttttgataatacgatactc
gcagaaatggcggctccgcccctgacaaccgtagcccagccgataaaagagatggggcgg
agcgtcatcgaactgctggcagaagcaatagagggaaaacgaaaggcgaaacaaaaaata
gtgctcccgcctgagcttgtagtcagacattctacatcaccgctcaacacatga

DBGET integrated database retrieval system