KEGG   Bacillus subtilis subsp. subtilis 168: BSU11150
Entry
BSU11150          CDS       T00010                                 

Symbol
yitV
Name
(RefSeq) esterase YitV
  KO
K06889  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU11150 (yitV)
SSDB
Motif
Pfam: Peptidase_S9 Hydrolase_4 DLH Abhydrolase_6 BD-FAE FSH1 Tannase BAAT_C ABHD18 LIP 3HBOH
Other DBs
NCBI-GeneID: 939350
NCBI-ProteinID: NP_388996
Pasteur: BG12246
BSORF: BG12246
UniProt: P70948 A0A6M4JGX8
Position
1191423..1192190
AA seq 255 aa
MIQIENQTVSGIPFLHIVKEENRHRAVPLVIFIHGFTSAKEHNLHIAYLLAEKGFRAVLP
EALHHGERGEEMAVEELAGHFWDIVLNEIEEIGVLKNHFEKEGLIDGGRIGLAGTSMGGI
TTLGALTAYDWIKAGVSLMGSPNYVELFQQQIDHIQSQGIEIDVPEEKVQQLMKRLELRD
LSLQPEKLQQRPLLFWHGAKDKVVPYAPTRKFYDTIKSHYSEQPERLQFIGDENADHKVP
RAAVLKTIEWFETYL
NT seq 768 nt   +upstreamnt  +downstreamnt
gtgatacaaattgagaatcaaaccgtttccggtattccgtttttacatattgtaaaggaa
gagaacaggcaccgcgctgttcctctcgtgatctttatacatggttttacaagcgcgaag
gaacacaaccttcatattgcttatctgcttgcggagaagggttttagagccgttctgccg
gaggctttgcaccatggggaacggggagaagaaatggctgttgaagagctggcggggcat
ttttgggatatcgtcctcaacgagattgaagagatcggcgtacttaaaaaccattttgaa
aaagagggcctgatagacggcggccgcatcggtctcgcaggcacgtcaatgggcggcatc
acaacgcttggcgctttgactgcatatgattggataaaagccggcgtcagcctgatggga
agcccgaattacgtggagctgtttcagcagcagattgaccatattcaatctcagggcatt
gaaatcgatgtgccggaagagaaggtacagcagctgatgaaacgtctcgagttgcgggat
ctcagccttcagccggagaaactgcaacagcgcccgcttttattttggcacggcgcaaaa
gataaagttgtgccttacgcgccgacccggaaattttatgacacgattaaatcccattac
agcgagcagccggaacgcctgcaatttatcggagatgaaaacgctgaccataaagtcccg
cgggcagctgtgttaaaaacgattgaatggtttgaaacgtacttataa

DBGET integrated database retrieval system