KEGG   Bacillus subtilis subsp. subtilis 168: BSU11660Help
Entry
BSU11660          CDS       T00010                                 

Gene name
tenI
Definition
(RefSeq) regulatory protein TenI
  KO
K10810  thiazole tautomerase (transcriptional regulator TenI) [EC:5.3.99.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU11660 (tenI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU11660 (tenI)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.10  thiazole tautomerase
     BSU11660 (tenI)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSU11660 (tenI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TMP-TENI His_biosynth NMO
Motif
Other DBs
NCBI-GeneID: 936411
NCBI-ProteinID: NP_389048
Pasteur: BG10792
BSORF: BG10792
UniProt: P25053 A0A0A1HAX7
Structure
PDB: 

Position
1243134..1243751
Genome map
AA seq 205 aa AA seqDB search
MELHAITDDSKPVEELARIIITIQNEVDFIHIRERSKSAADILKLLDLIFEGGIDKRKLV
MNGRVDIALFSTIHRVQLPSGSFSPKQIRARFPHLHIGRSVHSLEEAVQAEKEDADYVLF
GHVFETDCKKGLEGRGVSLLSDIKQRISIPVIAIGGMTPDRLRDVKQAGADGIAVMSGIF
SSAEPLEAARRYSRKLKEMRYEKAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtggagcttcacgccataacggatgacagcaagccggtagaagagctagcgagaatcatc
attacgattcagaatgaagttgattttattcacattcgggaacgctcaaaatcggcggcg
gatattttgaaactgctcgatcttatttttgaaggcggtatagataaacgaaaattggtg
atgaacgggcgcgtggatattgcacttttctctactattcaccgcgtgcagctgccaagc
ggcagcttttcaccgaagcagatcagagccagatttccacaccttcatatcgggaggtcg
gtgcattcactggaggaagcggttcaagcagaaaaggaagacgcggactacgtgctgttc
ggccatgtgtttgaaacggattgcaaaaagggtcttgaaggcagaggagtatctttgctg
tcagatatcaaacagcggatttccatcccggttatagccatcggggggatgacgccggac
aggttaagagacgtaaaacaagcaggggcagacggcattgctgttatgtcaggaattttc
tcttccgctgaacctttggaagcagccagacgatattcccgcaagctaaaggagatgcgc
tatgaaaaggcattatga

DBGET integrated database retrieval system