KEGG   Bacillus subtilis subsp. subtilis 168: BSU11690
Entry
BSU11690          CDS       T00010                                 

Gene name
thiG
Definition
(RefSeq) thiazole synthase
  KO
K03149  thiazole synthase [EC:2.8.1.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00895  Thiamine biosynthesis, prokaryotes, AIR (+ DXP/glycine) => TMP/TPP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU11690 (thiG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.10  thiazole synthase
     BSU11690 (thiG)
SSDB
Motif
Pfam: ThiG His_biosynth FMN_dh IMPDH NanE NMO DUF561
Other DBs
NCBI-GeneID: 936422
NCBI-ProteinID: NP_389051
Pasteur: BG13149
BSORF: BG13149
UniProt: O31618 A0A6M3Z9F8 A0A0A1HAX8
Structure
PDB: 
1XM3 1TYG

Position
1245041..1245811
AA seq 256 aa
MSMLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRMNIFEASQPNFLEQ
LDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDMIKVEVIGCSRSLLPDPVETLKASE
QLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQAKVP
VIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIP
LKQYGTASSPGEGLPV
NT seq 771 nt   +upstreamnt  +downstreamnt
atgagcatgttaacaattggcggaaaatcatttcaatcaagattgctgctgggcacgggg
aaatacccatcgtttgacattcaaaaggaagcagtagctgtttctgagtctgatatttta
acatttgctgtaaggagaatgaacatttttgaagcatctcagccgaattttctggaacag
cttgatttatccaaatatacgcttttgccgaatacagcgggcgccagtactgctgaagaa
gcggttcggattgcaaggctggcgaaagcttcaggcctttgtgacatgattaaagttgaa
gtcatcggatgcagccgttccttgctgcctgaccctgttgagacattaaaagcgtctgaa
cagcttcttgaagaaggctttattgtgctcccgtacacgtcggatgacgttgtgctggcg
agaaagctggaagagctcggcgttcatgccatcatgccgggtgcatctccgattggatca
ggacaaggaatcttaaatcctttgaatctgtcgtttattattgaacaggcgaaagtaccg
gtcatcgtggatgcgggaatcggctcgcctaaagatgcggcatacgcaatggagcttgga
gcggatggcgtactgctcaatacggctgtatctggcgctgacgatcccgtgaaaatggct
cgtgccatgaagctcgcagtggaagcagggcgcctttcttatgaggcgggccgaatcccg
cttaagcaatacggaacggcaagcagtccgggagaaggtcttcctgtatga

DBGET integrated database retrieval system