KEGG   Bacillus subtilis subsp. subtilis 168: BSU11700
Entry
BSU11700          CDS       T00010                                 

Symbol
thiF
Name
(RefSeq) sulfur carrier protein ThiS adenylyltransferase
  KO
K03148  sulfur carrier protein ThiS adenylyltransferase [EC:2.7.7.73]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
bsu04122  Sulfur relay system
Module
bsu_M00895  Thiamine biosynthesis, prokaryotes, AIR (+ DXP/glycine) => TMP/TPP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU11700 (thiF)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BSU11700 (thiF)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.73  sulfur carrier protein ThiS adenylyltransferase
     BSU11700 (thiF)
SSDB
Motif
Pfam: ThiF Shikimate_DH 3HCDH_N AlaDh_PNT_C NAD_binding_7 Sacchrp_dh_NADP DUF4866 DUF2072 FAD_binding_3 Pyr_redox_2 ApbA
Other DBs
NCBI-GeneID: 939816
NCBI-ProteinID: NP_389052
Pasteur: BG13150
BSORF: BG13150
UniProt: O31619 A0A6M3Z9I4 A0A0A1HAX3
Position
1245808..1246818
AA seq 336 aa
MTGRYSRQELFAPIGPSGQKKLKEARAVIIGAGALGTASAEMLVRAGVGSVKIADRDYVE
WSNLQRQQLYTEDDVKKEMPKAAAAERRLRSINSDVDVTGLVMDVTAENIFELIRDASII
VDAADNFETRLIVNDAAVKEGIPFLYGACVGSYGLTFTVVPGSTPCLHCLLDALPIGGAT
CDTAGIISPAVLQVAVFQVTDALKLLTGEECEPVLRSFDLWKNERSEVRAASLKHDACPS
CGTKDFPFLSYENQTKAAVLCGRNTVQIRSSITKEADLEALAGQLRQAGLEVAANPYLIS
CRSDDMKMVLFRDGRALIHGTNDIARAKSIYHKWIG
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgacaggcaggtattcaaggcaggagctgtttgctccgatcggcccatccggccagaaa
aaattgaaagaagcgcgcgccgtgattatcggcgccggcgcgctcggaacagccagtgca
gaaatgctggtgagagcgggagtcggctctgtgaaaattgccgacagagattatgttgaa
tggagcaacctccagcgccagcagctttatacagaagatgatgtcaaaaaagaaatgccg
aaagcagccgctgcggagcgccgtctccgttcgattaacagcgatgttgatgtgaccggc
cttgtcatggatgtgacagcagaaaatatcttcgagctgattagggatgcatcgattatt
gtggatgcggctgataattttgaaacccgcctgatcgtaaatgatgctgcggtaaaggaa
gggattccttttctttacggtgcctgtgtagggagctacggtcttacctttaccgtggtg
ccgggttctactccttgcctgcattgcttgctcgatgcacttccgattggcggagcaaca
tgtgacacagctggcatcatcagtccggctgttttgcaggtagcagtctttcaggtaaca
gatgcactgaaactgctgacgggagaggagtgcgagccggtgctgcgctcctttgatttg
tggaaaaacgagcggtcagaagtgagagcggccagtctcaaacatgacgcatgcccaagc
tgcggcacaaaggattttccgtttttgtcttatgaaaatcaaacaaaagcggctgtattg
tgcggcaggaacacggtgcagatcagatcatctattacgaaagaagcggatcttgaagcg
cttgccggtcagctgaggcaggccgggcttgaagtagctgcgaacccgtatttaatttcc
tgccgctcggatgatatgaaaatggtgctgttccgggacggcagagctttgatccatgga
acaaatgatattgcccgggcaaaatccatttatcataaatggattgggtaa

DBGET integrated database retrieval system