KEGG   Bacillus subtilis subsp. subtilis 168: BSU11790
Entry
BSU11790          CDS       T00010                                 

Gene name
yjcA
Definition
(RefSeq) sporulation protein YjcA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1360 Fst_toxin CCB1 CBL
Other DBs
NCBI-GeneID: 936428
NCBI-ProteinID: NP_389061
Pasteur: BG13154
BSORF: BG13154
UniProt: O31623 A0A6M3Z9R2
Position
1252177..1252533
AA seq 118 aa
MVINGLTIVLLSLAVFRLARLLVFDTIMAPLRSLFHEEKEEKDADGNIETYIVIKGTGVR
AFIGELLSCYWCTGVWCAGFLILCQAVIPQAAQWLILLLAIAGLAGIIETLVSKWLQE
NT seq 357 nt   +upstreamnt  +downstreamnt
gtggttataaatgggctgacaattgttcttctatcgcttgcggtctttcggctcgcccgc
ctgctggtgtttgacacgattatggcgccgcttcgcagtctgtttcatgaagagaaggaa
gaaaaggatgcggacgggaacattgaaacctatatcgtgattaagggaaccggtgtcagg
gcgtttattggtgaattgctgagctgctattggtgcacaggcgtgtggtgtgccggcttt
ttgattttatgccaggcggtgatcccgcaagcggcgcagtggctgattttacttttggcg
atcgccggccttgccggcattatagaaacgctcgtatcaaaatggctgcaagaataa

DBGET integrated database retrieval system