KEGG   Bacillus subtilis subsp. subtilis 168: BSU11850
Entry
BSU11850          CDS       T00010                                 

Gene name
yjcG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: 2_5_RNA_ligase2 LigT_PEase CPDase
Other DBs
NCBI-GeneID: 939822
NCBI-ProteinID: NP_389067
Pasteur: BG13160
BSORF: BG13160
UniProt: O31629 A0A6M4JF48
Structure
PDB: 
2D4G

Position
complement(1256862..1257377)
AA seq 171 aa
MKYGIVLFPSKKLQDLANSYRKRYDPSYSLIPPHLTLRASFECAEEKADQLVSHLRNIAK
ESHPLVLKMTKYSSFAPVNNVIYIKAEPTEELKTLNEKLYTGVLAGEQEYNFVPHVTVGQ
NLSDDEHSDVLGQLKMQEVSHEEIVDRFHLLYQLENGSWTVYETFLLGRGE
NT seq 516 nt   +upstreamnt  +downstreamnt
atgaaatacggaatcgttttatttccatcaaaaaagctccaagaccttgcaaactcttac
agaaagcgctatgacccaagctactctctaatcccgcctcatttgacgctgagagcatcc
tttgaatgcgcggaggagaaagcggatcagctcgtatcacatttaagaaacatcgcaaaa
gagtcccacccactcgttctcaaaatgacaaaatacagctcatttgcgcctgtcaataat
gtcatttacatcaaagcagaaccgacggaagagttaaaaacactcaatgaaaagctatac
accggtgtgttggcaggagaacaggaatataatttcgttccgcatgtgacggtcggccaa
aatctttccgacgatgagcattcagatgtgctgggacaattaaaaatgcaggaagtgtcg
catgaagaaatcgttgaccgtttccacttgctctaccagttggaaaacggatcgtggaca
gtatatgaaaccttcttgctaggcagaggagaataa

DBGET integrated database retrieval system