KEGG   Bacillus subtilis subsp. subtilis 168: BSU11960
Entry
BSU11960          CDS       T00010                                 

Gene name
yjcR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_terminase Terminase_5 Sigma70_r4_2 HTH_23 HTH_28 HIGH_NTase1_ass HTH_36 HTH_Tnp_1 HTH_3 MerR_1 HTH_26 DUF1804 DUF2498 Sigma70_r4 HTH_psq
Other DBs
NCBI-GeneID: 936443
NCBI-ProteinID: NP_389078
Pasteur: BG13171
BSORF: BG13171
UniProt: O31640 A0A6M3Z9Y7
Position
1267574..1268101
AA seq 175 aa
MAEKHIQAYKDYVKGMKYKDLAEKYGVSVNTIKSWKQRHGWERKKGAPIEKSVHTKKGGQ
PGNKNALGNNGGAPQKNQNAVTHGFFSKFLPEETLEIMEEIQERSPADMIWDQIQIQYAA
ILRAQKIMFVSDKEEMIKELKKKRSLISEVSEIEDGLVISFSTWFRYRLYSETNT
NT seq 528 nt   +upstreamnt  +downstreamnt
atggccgaaaagcacattcaggcgtataaggattacgtcaaaggcatgaaatacaaggac
cttgccgagaaatacggggtgtcagtgaacaccattaaatcgtggaagcagcggcatggt
tgggaaaggaaaaagggtgcacccattgaaaaaagtgtgcacacaaaaaaaggcgggcaa
ccgggcaacaaaaatgcattagggaacaatggcggcgcaccacagaagaatcaaaatgct
gtgactcacggctttttctctaaattcttgccagaagagacgcttgaaatcatggaagag
attcaggagcgttcgccagctgatatgatatgggatcagatacagattcaatatgcggcc
attcttcgggcgcaaaagatcatgttcgtttctgataaggaagaaatgatcaaagagctg
aaaaagaaaaggtccctcatatctgaggtcagcgaaattgaagatgggcttgtcattagt
tttagtacgtggtttcgctacagactttacagtgaaacaaacacctaa

DBGET integrated database retrieval system