KEGG   Bacillus subtilis subsp. subtilis 168: BSU12420
Entry
BSU12420          CDS       T00010                                 

Gene name
yjoB
Definition
(RefSeq) ATPase YjoB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AAA AAA_5 AAA_16 AAA_22 bpMoxR RNA_helicase RuvB_N NACHT ABC_tran AAA_7 Mg_chelatase AAA_24 TsaE AAA_29 Sigma54_activ_2 zf-NOSIP AAA_3 TIP49 AAA_28 NTPase_1 AAA_lid_3 AAA_18 Bac_DnaA
Other DBs
NCBI-GeneID: 936467
NCBI-ProteinID: NP_389124
Pasteur: BG13216
BSORF: BG13216
UniProt: O34703 A0A6M3Z9R4
Position
1314453..1315724
AA seq 423 aa
MTNIPFIYQYEEKENERAAAGYGTFGYLITRIEETLYDQYGVFYELYASDDPNTEYWELL
VEDVRSGSLEPEHVAYIFEKLEKKTFAYDEDEKEPDYTVHKSIRNSVYAYPEKGVAFARI
PYFQDGSIMSFDCLFAVNDEKMRAFLEGVRPRLWEKSKRKVTVFTDGDGGTSREQEAIVR
EVQRSQVIMNPLLKKEIYRSIDQFFHSDKSFYQTYDIPYKRGILLYGPPGNGKTTLVKSI
AGSIDAPVAYWQITEFTSSETIEEVFQAARRLAPAVLVIEDIDSMPEDVRSFFLNTLDGA
TSKEGLFLIGTTNYPEEIDPGLMNRAGRFDRAYEIGLPDEELRLEYMKMRGFGIFLSEGE
IKNAAKLTEGFSFAQLGELYVSSALQWHQEGNHHIETMVKDMTGEQRKSQRGSWMERNKV
GFH
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgactaacatacctttcatttatcagtacgaagaaaaagagaatgaaagagctgcggcg
ggctacggcactttcggttaccttatcacacggattgaagaaacgctttatgatcaatac
ggtgtattctatgagctctatgccagtgatgatccaaatacggaatactgggagcttctt
gtagaagatgtccgcagcggttcattggagcctgagcatgtggcatatatatttgaaaag
cttgaaaagaaaacctttgcttacgatgaagatgagaaagaaccggattataccgtccat
aagtctataagaaacagtgtatacgcgtatcctgaaaagggagttgcttttgccagaatt
ccatattttcaagatgggagcattatgagttttgattgtctgtttgcggttaacgatgaa
aagatgcgtgcatttctggagggagtcagaccgcgtctttgggaaaaaagcaagcggaaa
gtgaccgtgtttacggatggagatggagggacttcaagagagcaggaagccattgtcaga
gaggttcagcggagtcaagtcatcatgaatccgctattgaaaaaagagatatacagatca
attgatcagttttttcatagtgataaatcgttttatcaaacatatgacatcccttacaag
cgcggcattctgttatatggacctcctggaaacggaaagacgacgttagtgaagtcgatc
gcaggcagtatcgatgcacctgttgcttattggcaaattactgaatttacgtcgagcgag
acaatagaagaagtctttcaggcagcgagacgcctcgctcctgcagttctggtcatcgag
gatatagattcgatgccggaagatgtgcggtccttttttctcaatacgctggacggcgcg
acatcaaaagaggggctatttctcatcggtacgacaaactatcccgaagagatcgatcca
ggtttgatgaatcgtgcaggacgatttgaccgtgcctatgaaatcgggcttccggatgaa
gagctgcggctggaatatatgaaaatgagaggctttggcatctttttgagtgaaggagaa
ataaaaaacgccgcaaaacttacagaaggcttttcctttgcacagctgggagaattatat
gtatcttcagcccttcaatggcaccaagaagggaatcaccatattgaaaccatggtgaaa
gacatgacaggagagcaaagaaaaagccagcggggaagctggatggaaagaaacaaagtc
ggttttcactaa

DBGET integrated database retrieval system