KEGG   Bacillus subtilis subsp. subtilis 168: BSU12460
Entry
BSU12460          CDS       T00010                                 

Gene name
xlyB
Definition
(RefSeq) N-acetylmuramoyl-L-alanine amidase XlyB
  KO
K01447  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU12460 (xlyB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BSU12460 (xlyB)
SSDB
Motif
Pfam: Amidase_2 PG_binding_1 LysM
Other DBs
NCBI-GeneID: 936464
NCBI-ProteinID: NP_389128
Pasteur: BG12699
BSORF: BG12699
UniProt: O34391 A0A6M3ZAB0
Position
1317535..1318488
AA seq 317 aa
MSIPVKKNLVSEAKYALKCPNAMSAEYITIHNTANDASAANEISYMIGNTSSTSFHFAVD
DQEVIQGLPLNRNAWHTGDGTNGPGNRKSIGVEICYSKSGGPKYEAAEALAISFVAQLLK
ERGWGIDRVRKHQDWSGKYCPHRILSEGRWDQVKAAIEKELNGGVSAKKAAVSSSASEYH
VKKGDTLSGIAASHGASVKTLQSINHITDPNHIKIGQVIKLPQTASASKSHAASSYPLPS
GVIKVTSPLTQGTKVKQVQTALAALYFYPDKGAKNHGVDGVYGPKTANAVKRFQSVSGLT
ADGIYGPKTKAKMEEKL
NT seq 954 nt   +upstreamnt  +downstreamnt
gtgagcattccagtaaagaaaaatttggtttctgaggcgaaatacgcgttgaagtgtcct
aatgcaatgtccgctgaatacattaccattcacaacacggcaaacgatgcatcagcggcc
aatgaaatcagctatatgatcgggaacacaagctcgacaagctttcattttgcggtcgat
gatcaagaggtgattcaaggtctgccgcttaaccgaaacgcttggcacactggtgacggc
acaaacggtccgggaaaccgcaaatcaatcggtgttgagatttgctacagcaaatcggga
ggcccgaagtatgaggcagctgaagccttggcgatttcatttgttgcacagctgttgaag
gagcgcggctggggcatcgatcgggtgagaaagcatcaggactggagcggaaagtattgc
ccgcaccgcattttatcagaggggcgctgggatcaagtgaaggcggcgattgaaaaggaa
ttaaacgggggcgtatcagcgaaaaaagctgcagtctcttcttcggcgtctgaatatcat
gtaaaaaaaggtgacacactgtcagggattgccgcatcacacggggccagtgtgaaaacg
ctgcaaagcataaatcatatcactgacccgaaccacatcaaaatcggacaggtgatcaaa
ctgcctcagacggcatctgcttctaaaagccatgccgcatcctcatatccgctcccatcc
ggcgtgatcaaagtgacaagcccgctgacgcaagggacaaaagtaaagcaggtgcagact
gctttagccgctctttatttttatcctgataaaggagcgaaaaatcacggcgttgacggc
gtttatggcccgaaaacagctaatgcagtgaaacgttttcagtctgtcagcggtttaacg
gctgatgggatttacggtccgaaaacgaaagcgaagatggaggaaaagctgtaa

DBGET integrated database retrieval system