KEGG   Bacillus subtilis subsp. subtilis 168: BSU12510
Entry
BSU12510          CDS       T00010                                 

Gene name
xre
Definition
(RefSeq) XRE family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_26 Phage_CI_repr Sigma70_r4 HTH_Crp_2
Other DBs
NCBI-GeneID: 936473
NCBI-ProteinID: NP_389133
Pasteur: BG10994
BSORF: BG10994
UniProt: P23789 A0A6M3Z9R0
Position
complement(1321329..1321670)
AA seq 113 aa
MIGGRLKSLRGKRTQEEIASHIGVSRARYSHYENGRSEPDYDTLQKLADYFQVTTDYLLT
GKDKKSDDDMFSDPDLQLAYRDMQDFSPESKQQAIEFINYLKEKEKNRKPKNK
NT seq 342 nt   +upstreamnt  +downstreamnt
atgataggcggcagattgaagagtctcagagggaaaaggacacaggaagaaatcgcatca
cacatcggtgtgtcacgggcacgatattcccactatgaaaacgggcgaagcgaacccgat
tacgacacactccaaaagctggctgattactttcaagtaacgactgattacttattaacg
gggaaagacaaaaaatccgatgacgatatgttctcagatccggacctgcagcttgcatac
cgcgatatgcaggatttttccccagaaagcaaacagcaggccatcgaatttatcaactat
ttaaaagaaaaagagaaaaaccgcaaaccgaaaaataaataa

DBGET integrated database retrieval system