KEGG   Bacillus subtilis subsp. subtilis 168: BSU12530
Entry
BSU12530          CDS       T00010                                 

Gene name
xkdC
Definition
(RefSeq) phage-like element PBSX protein XkdC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: IstB_IS21 Bac_DnaA AAA_16 ATPase_2 AAA RuvB_N Zeta_toxin ATPase AAA_24 Viral_helicase1 AAA_22 AAA_19 NACHT AAA_14 DUF815 AAA_5 DO-GTPase2 AAA_30
Other DBs
NCBI-GeneID: 939841
NCBI-ProteinID: NP_389135
Pasteur: BG10996
BSORF: BG10996
UniProt: P39782 A0A6M4JHA1
Position
1322750..1323550
AA seq 266 aa
MTKRTIEQILDELRRGRRPLLADKPAESDASRYDCLRCKDQGGYLVRQNGLEVWTMCSCM
AERKVKRLLGASEITHAFRQLGFKEFRTEGKPQAIKDAFECTKEYVADYEQIKDCRKNSI
ALLGQPGSGKTHLLTAAANELMRTCYVPVIYFPFVEGFTDLKNDFALLEAKLNRMKQADV
LFIDDLFKPVNGKPRATDWQLEQMYSVLNYRYLNHKPILLSSELTIEGLVRVDEALGTRI
YEMCSDYLVIIKGAAYELNHRLEGVR
NT seq 801 nt   +upstreamnt  +downstreamnt
atgacaaaacgaacaatcgaacagattttggacgagctgagaagagggagacgtccatta
ctggcggacaaaccggccgaatcagacgcaagcaggtatgattgcctgcgctgcaaggat
cagggaggttatctcgtcaggcagaatggcctggaagtctggacgatgtgcagctgcatg
gcagaacgaaaagtgaagcggctgctgggtgcaagtgagattacccacgctttcagacag
ctcggcttcaaggaattccgcacggagggaaagccgcaggccataaaagacgcatttgag
tgtacaaaagagtatgttgccgattatgaacaaatcaaggattgccgaaaaaacagcatt
gcccttttaggacagcccggatcagggaaaacacaccttttgaccgccgcagccaacgaa
ttaatgagaacatgctatgtgcctgtcatttattttccgttcgtggaaggctttactgat
ctgaaaaatgattttgccctattagaagcgaagctgaaccggatgaagcaggcggatgtg
ctgttcattgatgatctgtttaaaccggttaacggcaaaccccgcgctacagattggcaa
ttagagcaaatgtattcggtactcaactatcgctacttaaatcataaaccgattttgctt
tcgagcgagctgacaattgaaggacttgtacgggtcgatgaagcgctcggcacgagaatc
tatgagatgtgcagtgactatttagtgattatcaaaggagcagcctacgagcttaaccat
agattggagggcgtcagataa

DBGET integrated database retrieval system