KEGG   Bacillus subtilis subsp. subtilis 168: BSU12610
Entry
BSU12610          CDS       T00010                                 

Gene name
xkdG
Definition
(RefSeq) phage-like element PBSX protein XkdG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_capsid SAM_Exu
Other DBs
NCBI-GeneID: 939845
NCBI-ProteinID: NP_389143
Pasteur: BG11542
BSORF: BG11542
UniProt: P54327 A0A6M3Z9T2
Position
1329555..1330490
AA seq 311 aa
MRNQEIIRKAEMSLSALKSGGLMNPAQASAFIRMVQNTPTIFSESRVIQMENDSQKFEKI
GFGQRILRAAQEGKALSNDELTVPTTSTVQLNTKEVIAEINITYDTLENNIEKDGLQQTI
MQILAERAAVDIEELIVNGDTASADPYLAQLDGIRKQAVSHIVDMNGEELSRATFKKGLK
AVPPKYLRIPQEFRFYTSHGLEVEWKDRVADRQTNLGDQAVQGGLSTAFGVPVKGVSNIQ
PYTVGEGDAQYDASDIILTHPKNIILGFSRNIRIEVDKDIRSRKFIIVLTAKLDSKFEEE
DACAKLINVKE
NT seq 936 nt   +upstreamnt  +downstreamnt
ttgagaaatcaagagatcattcggaaagcggaaatgtcgctttctgctttaaaaagcggc
gggcttatgaaccctgcgcaagcatcggcttttatccgcatggtgcaaaacacgccgacc
attttcagtgaatcccgcgtgattcaaatggaaaacgattcgcaaaaatttgaaaaaatc
ggcttcggccagcgtattctgcgggctgcgcaagaaggaaaagcactgtcaaacgacgag
ctgacagttccaacgacaagcactgtccagctgaacacgaaggaagtcattgcggaaatc
aacattacgtatgacacacttgaaaacaatattgaaaaagacggcctgcagcagacaatc
atgcaaattttagcagagcgcgcagcagttgatattgaagagctgatcgttaacggcgat
acagcatcagctgatccgtatctggcacagctggacggcatccgtaaacaggcggtttcc
catatcgttgacatgaacggtgaagaactgtccagagcgacattcaagaagggcttaaag
gcagttccgccgaaatatttgcgcatccctcaggaattcagattctatacgtctcacggc
ttagaagttgaatggaaggaccgcgtggcagaccgccagacaaaccttggggaccaagct
gttcagggcggcttgtcaacagcattcggcgtaccggtcaaaggggtatccaatattcag
ccgtacacagtcggtgagggagacgcgcaatatgacgcttctgatatcattctcacacat
ccgaaaaatatcattctcggcttctcccgcaatatccgaattgaagtcgacaaagacatc
cgctcccgtaaattcattattgtcttaacggccaagctggacagcaagttcgaggaagag
gatgcctgcgcgaaattaattaacgtaaaagaataa

DBGET integrated database retrieval system