KEGG   Bacillus subtilis subsp. subtilis 168: BSU12810
Entry
BSU12810          CDS       T00010                                 

Gene name
xlyA
Definition
(RefSeq) N-acetylmuramoyl-L-alanine amidase XlyA
  KO
K01447  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU12810 (xlyA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BSU12810 (xlyA)
SSDB
Motif
Pfam: Amidase_2 LysM PG_binding_1 HTH_28
Other DBs
NCBI-GeneID: 939869
NCBI-ProteinID: NP_389164
Pasteur: BG10962
BSORF: BG10962
UniProt: P39800 A0A6M4JHQ2
Structure
PDB: 
3RDR 3HMB

Position
1347289..1348182
AA seq 297 aa
MVNIIQDFIPVGANNRPGYAMTPLYITVHNTANTAVGADAAAHARYLKNPDTTTSWHFTV
DDTEIYQHLPLNENGWHAGDGNGSGNRASIGIEICENADGDFAKATANAQWLIKTLMAEH
NISLANVVPHKYWSGKECPRKLLDTWDSFKAGIGGGGSQTYVVKQGDTLTSIARAFGVTV
AQLQEWNNIEDPNLIRVGQVLIVSAPSAAEKPELYPLPDGIIQLTTPYTSGEHVFQVQRA
LAALYFYPDKGAVNNGIDGVYGPKTADAVARFQSVNGLTADGIYGPATKEKIAAQLS
NT seq 894 nt   +upstreamnt  +downstreamnt
atggttaacattattcaagactttattccggttggcgcaaataaccgtccaggctacgca
atgacgccgctttacattacggtgcacaacacagcgaataccgcagtaggagcagatgct
gcagcgcatgcccgctatttgaaaaatcctgatacgacgacaagctggcattttacagtt
gatgatacagaaatttatcagcatctgcctttaaatgaaaacggctggcatgcgggagac
ggaaatggcagcggcaaccgggcttctattggaattgaaatttgcgaaaatgccgatggc
gattttgcaaaagcaacagcaaatgcccagtggctcatcaaaacattaatggctgaacat
aatatcagtctcgccaatgtcgtccctcataagtattggtcagggaaggaatgtccgcga
aaattgttagatacgtgggattcgttcaaagcaggaattgggggaggcggcagccaaact
tacgtcgtgaaacagggcgacacacttacatctatagcgagagcatttggtgttacggtt
gctcagctgcaagagtggaacaatatcgaagacccgaatcttattcgcgttggtcaagta
ttaattgtaagtgctccatcggctgctgaaaaacccgagctctatccgctccctgatggt
atcattcaattgacaacaccttatacatcaggagaacacgtctttcaggtgcaacgagca
cttgcggctctgtatttttaccctgataaaggcgctgttaacaacggaattgacggcgtt
tacggaccgaaaacagctgacgcagttgcccgttttcagtctgttaacggtctaactgct
gacggtatctacgggcctgcgacgaaagagaagatcgcagcgcaattaagctga

DBGET integrated database retrieval system