KEGG   Bacillus subtilis subsp. subtilis 168: BSU12830
Entry
BSU12830          CDS       T00010                                 

Gene name
spoIISA
Definition
(RefSeq) stage II sporulation protein SA
  KO
K06388  stage II sporulation protein SA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU12830 (spoIISA)
SSDB
Motif
Pfam: SpoIISA_toxin
Other DBs
NCBI-GeneID: 938174
NCBI-ProteinID: NP_389166
Pasteur: BG12677
BSORF: BG12677
UniProt: O34853 A0A6M3ZA69
Structure
PDB: 
3O6Q

Position
complement(1348612..1349358)
AA seq 248 aa
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSL
FTHWERYLIVAVSFALIDAFIFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTY
QYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASLCHYSTQADKDRLTEHMDDPA
DVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
NT seq 747 nt   +upstreamnt  +downstreamnt
atggttttattctttcagatcatggtctggtgcatcgtggccggactggggttatacgtg
tatgccacgtggcgtttcgaagcgaaggtcaaagaaaaaatgtccgccattcggaaaact
tggtatttgctgtttgttctgggcgctatggtatactggacatatgagcccacttcccta
tttacccactgggaacggtatctcattgtcgcagtcagttttgctttgattgatgctttt
atcttcttaagtgcatatgtcaaaaaactggccggcagcgagcttgaaacagacacaaga
gaaattcttgaagaaaacaacgaaatgctccacatgtatctcaatcggctgaaaacatac
caatacctattgaaaaacgaaccgatccatgtttattatggaagtatagatgcttatgct
gaaggtattgataagctgctgaaaacctatgctgataaaatgaacttaacggcttctctt
tgccactattcgacacaggctgataaagaccggttaaccgagcatatggatgatccggca
gatgtacaaacacggctcgatcgaaaggatgtttattacgaccaatacggaaaagtggtt
ctcatcccttttaccatcgagacacagaactatgtcatcaagctgacgtctgacagcatt
gtcacggaatttgattatttgctatttacgtcattaacgagcatatatgatttggtgctg
ccaattgaggaggaaggtgaaggataa

DBGET integrated database retrieval system