KEGG   Bacillus subtilis subsp. subtilis 168: BSU13170
Entry
BSU13170          CDS       T00010                                 

Gene name
guaD
Definition
(RefSeq) guanine deaminase
  KO
K01487  guanine deaminase [EC:3.5.4.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU13170 (guaD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.3  guanine deaminase
     BSU13170 (guaD)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam SNAD4 NAD1 NAD2 APOBEC2
Other DBs
NCBI-GeneID: 936695
NCBI-ProteinID: NP_389200
Pasteur: BG13240
BSORF: BG13240
UniProt: O34598 A0A6M3Z9S7
Structure
PDB: 
1WKQ 1TIY

Position
complement(1382677..1383147)
AA seq 156 aa
MNHETFLKRAVTLACEGVNAGIGGPFGAVIVKDGAIIAEGQNNVTTSNDPTAHAEVTAIR
KACKVLGAYQLDDCILYTSCEPCPMCLGAIYWARPKAVFYAAEHTDAAEAGFDDSFIYKE
IDKPAEERTIPFYQVTLTEHLSPFQAWRNFANKKEY
NT seq 471 nt   +upstreamnt  +downstreamnt
atgaatcatgaaacgttcttaaaacgggctgtcactctcgcatgtgaaggagtgaatgca
ggaatcggcgggccttttggagccgttatcgtgaaagacggagccattattgcagaggga
cagaacaacgtcacaacaagcaatgatccgactgcccacgcggaagtcacagctattcgg
aaagcctgtaaggtgctaggagcctaccagcttgatgactgcattttgtatacgagctgt
gaaccatgcccaatgtgcttgggcgccatctactgggcccggcctaaagccgttttctat
gcagctgagcacacagacgctgccgaagccgggtttgatgattcattcatttataaagaa
attgataaacctgctgaagaaagaacgatccccttttatcaagtgacactaacagagcat
ttatccccgtttcaagcatggcggaacttcgccaataagaaagaatattaa

DBGET integrated database retrieval system