KEGG   Bacillus subtilis subsp. subtilis 168: BSU13400
Entry
BSU13400          CDS       T00010                                 

Gene name
ligD
Definition
(RefSeq) ATP-dependent DNA ligase YkoU
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BSU13400 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU13400 (ligD)
Enzymes [BR:bsu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BSU13400 (ligD)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BSU13400 (ligD)
SSDB
Motif
Pfam: DNA_ligase_A_M RNA_ligase
Other DBs
NCBI-GeneID: 939372
NCBI-ProteinID: NP_389223
Pasteur: BG13264
BSORF: BG13264
UniProt: O34398 A0A6M3ZA14
Position
complement(1404518..1406353)
AA seq 611 aa
MAFTMQPVLTSSPPIGAEWRYEVKYDGYRCILRIHSSGVTLTSRNGVELSSTFPEITQFA
KTAFQHLEKELPLTLDGEIVCLVNPCRADFEHLQVRGRLKRPDKIQESANARPCCFLAFD
LLERSGEDVTLLSYLDRKKSLRELISAAKLPASPDPYAKETIQSIPCYDHFDQLWEMVIK
YDGEGIVAKKTNSKWLEKKRSSDWLKYKNFKQAYVCITGFNPNNGFLTVSVLKNGIMTPI
ASVSHGMRDEEKSAIREIMEQHGHQTPSGEFTLEPSICAAVQYLTILQGTLREVSFIGFE
FQMDWTECTYAQVIRHSKPVHPKLQFTSLDKIIFEKNKKTKEDFIQYMIEVSDYLLPFLK
NRAVTVIRYPHGSRSESFFQKNKPDYAPDFVQSFYDGSHEHIVCEDMSTLLWLCNQLALE
FHVPFQTIKSRRPAEIVIDLDPPSRDDFLMAVQAANELKRLLDSFGITSYPKLSGNKGIQ
LYIPLSPEAFTYEETRQFTQLIAEYCTNAFPELFTTERLIKNRHCKLYLDYLQHAEGKTI
ICPYSTRGNELGTVAAPLYWHEVQSSLTPALFTIDTVIDRIKKQGCPFFDFYRNPQDEPL
SAILHQLKKKS
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggcgtttaccatgcagccggtcttaacttcgtcaccgccaatcggagcagaatggcgt
tacgaagtaaaatatgatgggtaccgctgtattctccgcatccattcttcaggtgtgacc
ttaaccagcagaaatggtgtggagctcagcagcaccttccctgaaatcacacaattcgcc
aaaactgcctttcagcacctagaaaaagagcttccgctgacacttgacggtgaaatcgta
tgtttggtgaatccctgtcgtgcagattttgaacaccttcaagtgcgggggcgtttgaaa
aggccagacaagattcaggaatcggcaaacgcgcggccgtgctgctttctcgcctttgat
ttgttagagcgaagcggagaagatgtaacgcttctttcgtatttggaccgcaaaaaatcg
ctgcgtgaactcatatccgcagcaaagcttcctgcatctccagatccttacgcaaaagaa
accattcaatccattccctgttatgatcattttgatcaactctgggagatggtaataaaa
tatgacggagaaggaattgtagcgaagaaaacaaacagcaaatggcttgaaaagaagcgg
tcgtccgattggctcaaatataaaaactttaaacaagcttatgtttgcataacagggttc
aaccctaacaacgggtttctgacggtatcggtgttaaaaaacggaataatgacaccgatt
gcctctgtctcgcacggaatgcgtgatgaggaaaaaagcgctatacgcgagattatggaa
cagcacggacatcaaacaccctcaggcgaatttacgcttgaaccttcgatttgtgcagct
gttcaatacttaacaattctccaaggcacattaagagaggtatcgtttatcggtttcgaa
ttccaaatggactggaccgaatgcacgtatgcgcaagtcatacgacactccaaaccggtt
cacccaaagctccagttcacaagcctggataaaatcatatttgaaaagaataaaaaaaca
aaagaagattttattcagtatatgattgaagtcagtgactacctgctcccatttctgaaa
aaccgggctgtcaccgtcatccgctatccgcatggatctaggagcgaatcatttttccaa
aaaaacaagccggactatgcgccggattttgttcagtctttctatgatggaagccatgaa
catattgtctgtgaggatatgtctacattgctatggctttgcaaccagcttgctttggag
tttcacgttccttttcaaaccattaaaagcaggcgtccggctgagattgtcattgattta
gacccgccttcgcgagatgactttcttatggccgtgcaggccgcaaatgaactgaagcgg
ctgttggattcctttggcatcacatcgtacccgaagctgtccggcaacaaaggcatccag
ctttatattcccttgtctcccgaggcatttacgtatgaagaaacacgccaatttacgcag
ctgatcgcagagtactgcaccaatgcatttcccgagctctttaccactgaacgcttgatt
aaaaacagacactgcaaattgtatcttgattatttgcagcatgcagaaggaaaaacgatt
atctgtccctattcaacgagaggaaatgagcttgggactgttgcagccccgctctactgg
catgaggtgcaatcatctttaacacccgctctgtttacaattgatacggtcatcgatcga
attaagaagcagggctgcccattttttgatttttaccgcaacccgcaagacgaaccgctt
agcgctatattgcatcagttgaagaaaaagagctga

DBGET integrated database retrieval system