KEGG   Bacillus subtilis subsp. subtilis 168: BSU13990Help
Entry
BSU13990          CDS       T00010                                 

Gene name
kinA
Definition
(RefSeq) sporulation kinase A
  KO
K02491  two-component system, sporulation sensor kinase A [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Module
bsu_M00485  KinABCDE-Spo0FA (sporulation control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU13990 (kinA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU13990 (kinA)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU13990 (kinA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU13990 (kinA)
Protein kinases [BR:bsu01001]
 Histidine kinases
  Spo family [OT]
   BSU13990 (kinA)
Two-component system [BR:bsu02022]
 Spo family
  KinABCDE-Spo0FA [MD:M00485]
   BSU13990 (kinA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS PAS_9 HATPase_c PAS_3 HisKA PAS_4 PAS_11 PAS_8 HATPase_c_2 HATPase_c_5 HATPase_c_3 DUF4994 HPTransfase
Motif
Other DBs
NCBI-GeneID: 939230
NCBI-ProteinID: NP_389282
Pasteur: BG10204
BSORF: BG10204
UniProt: P16497
Structure
PDB: 

Position
1470026..1471846
Genome map
AA seq 606 aa AA seqDB search
MEQDTQHVKPLQTKTDIHAVLASNGRIIYISANSKLHLGYLQGEMIGSFLKTFLHEEDQF
LVESYFYNEHHLMPCTFRFIKKDHTIVWVEAAVEIVTTRAERTEREIILKMKVLEEETGH
QSLNCEKHEIEPASPESTTYITDDYERLVENLPSPLCISVKGKIVYVNSAMLSMLGAKSK
DAIIGKSSYEFIEEEYHDIVKNRIIRMQKGMEVGMIEQTWKRLDGTPVHLEVKASPTVYK
NQQAELLLLIDISSRKKFQTILQKSRERYQLLIQNSIDTIAVIHNGKWVFMNESGISLFE
AATYEDLIGKNIYDQLHPCDHEDVKERIQNIAEQKTESEIVKQSWFTFQNRVIYTEMVCI
PTTFFGEAAVQVILRDISERKQTEELMLKSEKLSIAGQLAAGIAHEIRNPLTAIKGFLQL
MKPTMEGNEHYFDIVFSELSRIELILSELLMLAKPQQNAVKEYLNLKKLIGEVSALLETQ
ANLNGIFIRTSYEKDSIYINGDQNQLKQVFINLIKNAVESMPDGGTVDIIITEDEHSVHV
TVKDEGEGIPEKVLNRIGEPFLTTKEKGTGLGLMVTFNIIENHQGVIHVDSHPEKGTAFK
ISFPKK
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
gtggaacaggatacgcagcatgttaaaccacttcaaacaaaaaccgatattcatgcagtc
ttggcctctaatggacgcatcatttatatatctgccaactccaaactgcatttgggctat
ctccaaggagagatgatcggatcattcctcaaaacgtttctgcatgaggaagaccaattt
ttggttgaaagctatttttataatgaacatcatctgatgccgtgcacctttcgttttatt
aaaaaagatcatacgattgtgtgggtggaggctgcggtagaaattgttacgacaagagct
gagcggacagaacgggaaatcattttgaaaatgaaggttcttgaagaagaaacaggccat
caatccctaaactgcgaaaaacatgaaatcgaacctgcaagcccggaatcgactacatat
ataacggatgattatgaacggttggttgaaaatctcccgagtccgctatgcatcagtgtc
aaaggcaagatcgtctatgtaaacagcgcgatgctttcaatgctgggagccaaaagcaag
gatgctattattggtaaatcgtcctatgaatttattgaagaagaatatcatgatatcgtg
aaaaacaggattatacgaatgcaaaaaggaatggaagtcggaatgattgaacagacgtgg
aaaaggcttgatggcacacctgttcatttagaagtgaaagcatccccgaccgtctacaaa
aaccagcaggctgagctgctgctgctgatcgatatctcttcaaggaaaaaattccaaacc
atcctgcaaaaaagccgtgaacgatatcagctgctgattcaaaattccattgataccatt
gcggtgattcacaatggaaaatgggtatttatgaatgaatcgggaatttccctgtttgaa
gcggctacatatgaggatttaattggcaaaaacatatacgatcagctgcatccttgcgat
cacgaggatgtaaaagagagaatccaaaacattgccgagcaaaaaacagaatctgaaatt
gtcaagcaatcctggttcacctttcagaacagggtcatctatacggagatggtctgcatt
ccgacgaccttttttggtgaagcggccgtccaggtcattcttcgggacatctcagagaga
aaacaaacagaagaattgatgctgaaatcggaaaaattatcaatcgcagggcagctcgcg
gcgggaatcgcccatgagatccgcaaccctcttacagcgatcaaaggatttttacagctg
atgaaaccgacaatggaaggcaacgaacattactttgatattgtgttttctgaactcagc
cgtatcgaattaatactcagtgaactgctcatgctggcgaaacctcagcaaaatgctgtc
aaagaatatttgaacttgaaaaaattaattggtgaggtttcagccctgttagaaacgcag
gcgaatttaaatggcatttttatcagaacaagttatgaaaaagacagcatttatataaac
ggggatcaaaaccaattaaagcaggtattcattaatttaatcaaaaatgcagttgaatca
atgcctgatgggggaacagtagacattatcataaccgaagatgagcattctgttcatgtt
actgtcaaagacgaaggggaaggtatacctgaaaaggtactaaaccggattggagagcca
tttttaacaacaaaagaaaaaggtacggggcttggattaatggtgacatttaatatcatt
gaaaaccatcagggagttatacatgtggacagccatcctgaaaaaggcacagcgtttaaa
atttcatttccaaaaaaataa

DBGET integrated database retrieval system