KEGG   Bacillus subtilis subsp. subtilis 168: BSU14360Help
Entry
BSU14360          CDS       T00010                                 

Gene name
yknY
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00258  Putative ABC transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU14360 (yknY)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    BSU14360 (yknY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_16 AAA_23 APS_kinase AAA_30 G-alpha AAA_7 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 938766
NCBI-ProteinID: NP_389319
Pasteur: BG13245
BSORF: BG13245
UniProt: O31711
Position
1505416..1506108
Genome map
AA seq 230 aa AA seqDB search
MIQLSNVRKSYQIGKETFDVLHSIDLDIHQGEYVSIMGPSGSGKSTIMNIIGCLDRPTSG
TYQLDGEDISSYKDKELAAVRNRSIGFVFQQFQLLPRLNAKKNVELPMIYSGIGKKERQE
RAERALEKVGLADRMLHMPNELSGGQKQRVAIARAIVNEPKLILADEPTGALDTKTSEAI
MDQFTALNAEGTTIVLVTHEPEVADCTNRIVMVRDGNIVPASSGQRSVGE
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgattcagctttctaatgtgcgaaaaagctaccagatcggaaaggaaacgtttgatgtt
ctccattctattgatttggacattcatcaaggtgaatatgtctcgattatggggccgtca
ggatcaggaaaatcgacgatcatgaatattatcggctgtcttgatcggccgacttccggt
acatatcaattggacggcgaagacatttcttcatataaagataaagaactggcggcagtc
cgtaaccggtccatcggttttgtatttcagcaatttcagcttcttccgcggctgaacgca
aaaaaaaatgtcgagctgccgatgatttattccgggataggcaaaaaggaacgtcaagag
cgggctgagagagcattggaaaaggtcgggttagccgatcgaatgctccacatgcccaac
gagctgtcgggcgggcagaagcagcgggtggcgattgcgagggcgatcgtgaatgagccg
aaattgattttagctgatgaaccgaccggcgcgctggatacgaaaacaagcgaggcgatt
atggatcagtttacagcattaaatgccgagggaacgacaatcgttctggttactcacgag
cctgaagtagcagattgcacgaatcggatcgtcatggtgcgtgacggaaacattgttcct
gccagctccggacaaaggagtgtgggagaatga

DBGET integrated database retrieval system