KEGG   Bacillus subtilis subsp. subtilis 168: BSU14360
Entry
BSU14360          CDS       T00010                                 
Symbol
yknY
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K24949  antimicrobial peptide resistance transport system ATP-binding protein [EC:7.6.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU14360 (yknY)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Antimicrobial peptide resistance transporter
    BSU14360 (yknY)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_16 AAA_23 RsgA_GTPase APS_kinase AAA_30 DUF5906 ABC_ATPase G-alpha MMR_HSR1
Other DBs
NCBI-GeneID: 938766
NCBI-ProteinID: NP_389319
Pasteur: BG13245
UniProt: O31711 A0A6M3ZA95
Position
1505416..1506108
AA seq 230 aa
MIQLSNVRKSYQIGKETFDVLHSIDLDIHQGEYVSIMGPSGSGKSTIMNIIGCLDRPTSG
TYQLDGEDISSYKDKELAAVRNRSIGFVFQQFQLLPRLNAKKNVELPMIYSGIGKKERQE
RAERALEKVGLADRMLHMPNELSGGQKQRVAIARAIVNEPKLILADEPTGALDTKTSEAI
MDQFTALNAEGTTIVLVTHEPEVADCTNRIVMVRDGNIVPASSGQRSVGE
NT seq 693 nt   +upstreamnt  +downstreamnt
atgattcagctttctaatgtgcgaaaaagctaccagatcggaaaggaaacgtttgatgtt
ctccattctattgatttggacattcatcaaggtgaatatgtctcgattatggggccgtca
ggatcaggaaaatcgacgatcatgaatattatcggctgtcttgatcggccgacttccggt
acatatcaattggacggcgaagacatttcttcatataaagataaagaactggcggcagtc
cgtaaccggtccatcggttttgtatttcagcaatttcagcttcttccgcggctgaacgca
aaaaaaaatgtcgagctgccgatgatttattccgggataggcaaaaaggaacgtcaagag
cgggctgagagagcattggaaaaggtcgggttagccgatcgaatgctccacatgcccaac
gagctgtcgggcgggcagaagcagcgggtggcgattgcgagggcgatcgtgaatgagccg
aaattgattttagctgatgaaccgaccggcgcgctggatacgaaaacaagcgaggcgatt
atggatcagtttacagcattaaatgccgagggaacgacaatcgttctggttactcacgag
cctgaagtagcagattgcacgaatcggatcgtcatggtgcgtgacggaaacattgttcct
gccagctccggacaaaggagtgtgggagaatga

DBGET integrated database retrieval system