KEGG   Bacillus subtilis subsp. subtilis 168: BSU14930
Entry
BSU14930          CDS       T00010                                 

Symbol
ctaG
Name
(RefSeq) cytochrome c oxidase assembly factor CtaG
  KO
K02862  putative membrane protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU14930 (ctaG)
SSDB
Motif
Pfam: Caa3_CtaG DUF3935
Other DBs
NCBI-GeneID: 939909
NCBI-ProteinID: NP_389376
Pasteur: BG12579
BSORF: BG12579
UniProt: O34329 A0A6M3ZAF6
Position
1564422..1565315
AA seq 297 aa
MNQLEIFGFRAMWSPYLFCILLGITALYLYFYRRMSSKPNRITGKEMVCFLSAMLFLYAA
EGSPVDLLGHIMFSAHMVQMAVLYLVVPPLLIAGIPAWLWEKIIFRPSIKPVFSFFTTPL
IALLLFNGIFSLYHVPLIFDTVKTDPFYHTLITWLIFVLAFFMWWPLVHKVERLRQLSGL
MKLGYIMADGMLLTPACALIMFSGAPLYATYTDPALWAEAMRLCVPADMMGQVPLTGPEM
LNTLPLLEDQQLGAVMMKIIQEIVYGTFLAVIFFQWVKKEREKDGQEEPPYIQQTIS
NT seq 894 nt   +upstreamnt  +downstreamnt
atgaatcagttggagatatttgggtttcgcgcgatgtggagcccttatcttttttgtatc
ctgttaggcattacggcgctttatctctatttttacaggcgaatgtcttcaaagccgaat
cgaataactggtaaagagatggtgtgctttctgtcggcgatgctgtttttatatgcagcc
gagggaagcccggttgatctgctcggacatattatgttcagtgcgcatatggtgcagatg
gccgtcctgtatttggttgtcccgccgctgttaatcgcggggattcctgcatggctctgg
gaaaaaatcattttcaggccttcaatcaaaccggttttttccttttttacgacgccttta
attgctttgcttttgtttaacggcattttttctttatatcatgtaccgcttatatttgat
actgtcaaaacagatccgttttaccatacattaatcacttggcttatctttgtgcttgcg
ttcttcatgtggtggccgcttgttcataaggttgagcgtctacggcagctcagcggcttg
atgaagctgggttatattatggcggacggtatgctgctcacacctgcttgcgccttgatc
atgttcagcggtgcaccgttatacgccacctatacagatccggctttatgggctgaggca
atgaggctttgcgtgccagcggatatgatggggcaggtcccattaacagggccagagatg
ttgaatacactgcctttgttagaggatcagcagctcggagcagtcatgatgaaaatcatt
caggaaattgtgtacggtacttttttggccgttatttttttccaatgggtgaagaaagaa
agggaaaaggacgggcaggaggagccgccgtatattcagcagacgatatcataa

DBGET integrated database retrieval system