KEGG   Bacillus subtilis subsp. subtilis 168: BSU15300
Entry
BSU15300          CDS       T00010                                 

Symbol
bpr
Name
(RefSeq) bacillopeptidase F
  KO
K13276  bacillopeptidase F [EC:3.4.21.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU15300 (bpr)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU15300 (bpr)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BSU15300 (bpr)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S8: subtilisin family
   BSU15300 (bpr)
Chaperones and folding catalysts [BR:bsu03110]
 Intramolecular chaperones
  Subtilisin family
   BSU15300 (bpr)
SSDB
Motif
Pfam: Peptidase_S8 Glucodextran_B CarbopepD_reg_2 CarboxypepD_reg Inhibitor_I9 Big_13 Big_6 PEGA DUF1416 Big_7
Other DBs
NCBI-GeneID: 939695
NCBI-ProteinID: NP_389413
Pasteur: BG10233
BSORF: BG10233
UniProt: P16397 A0A6M4JLM2
Position
1599283..1603584
AA seq 1433 aa
MRKKTKNRLISSVLSTVVISSLLFPGAAGASSKVTSPSVKKELQSAESIQNKISSSLKKS
FKKKEKTTFLIKFKDLANPEKAAKAAVKKAKSKKLSAAKTEYQKRSAVVSSLKVTADESQ
QDVLKYLNTQKDKGNADQIHSYYVVNGIAVHASKEVMEKVVQFPEVEKVLPNEKRQLFKS
SSPFNMKKAQKAIKATDGVEWNVDQIDAPKAWALGYDGTGTVVASIDTGVEWNHPALKEK
YRGYNPENPNEPENEMNWYDAVAGEASPYDDLAHGTHVTGTMVGSEPDGTNQIGVAPGAK
WIAVKAFSEDGGTDADILEAGEWVLAPKDAEGNPHPEMAPDVVNNSWGGGSGLDEWYRDM
VNAWRAADIFPEFSAGNTDLFIPGGPGSIANPANYPESFATGATDINKKLADFSLQGPSP
YDEIKPEISAPGVNIRSSVPGQTYEDGWDGTSMAGPHVSAVAALLKQANASLSVDEMEDI
LTSTAEPLTDSTFPDSPNNGYGHGLVNAFDAVSAVTDGLGKAEGQVSVEGDDQEPPVYQH
EKVTEAYEGGSLPLTLTAEDNVSVTSVKLSYKLDQGEWTEITAKRISGDHLKGTYQAEIP
DIKGTKLSYKWMIHDFGGHVVSSDVYDVTVKPSITAGYKQDFETAPGGWVASGTNNNWEW
GVPSTGPNTAASGEKVYGTNLTGNYANSANMNLVMPPIKAPDSGSLFLQFKSWHNLEDDF
DYGYVFVLPEGEKNWEQAGVYNGKTSSWTDEEIDLSAYKGQNIQVMFNLQSDESIAKEGW
YIDDVVLSDKSAGKTVKKNKLGVEKPSGKQKKKPVNPKKAKPSANTAVKHQNKAIQPQVL
PLKAQVSVVETGKSTYSDQSTGQYTLKHKAGDYTLMAEAYGYQSKTQKVSLKTDQTTQAN
FTLEEMKKGTLKGTVINKTTGEPVTGASVYVVEDAAVEPAMTNDKGEYMLEAYEGAYTIK
VAAPGYYSDEFSVELKGDVTKETALKPFVGYPGEIAYDDGTAENANSYFAAGNGWAVKMT
LADGKDKGMLTGGLFRFWDTEFPDPGGTEFKVEVYDATGKDGAPGKKIAGPFNAEALRNG
EWTKVDLSSKGIMVDKDFYLVYIQSKPDPYSPGLAMDETGQNSGRNWQYIDGKWQPGDKA
DGNYMIRALVDYEAAVPEITSPTDKSYTNKDSVTVKGNASPGTTVHIYNGEKEAGETKAA
ADGTFHAGIILNKGENELTATASTDNGTTDASSPITVTLDQEKPELTLDNPKDGGKTNKE
TLTVKGAVSDDNLKDVKVNGKKATVADGSYSARILLENGRNEIKVIATDLAGNKTTKKTV
IDVNFDKPVISGLIPGEDKNLKAGESVKIAFSSAEDLDATFTIRMPLTNARASVQNATEL
PLREISPGRYEGYWTATSSIKAKGAKVEVIVRDDYGNETRKTANGKLNMNTEN
NT seq 4302 nt   +upstreamnt  +downstreamnt
atgaggaaaaaaacgaaaaacagactcatcagctctgttttaagtacagttgtcatcagt
tcactgctgtttccgggagcagccggggcaagcagtaaagtcacctcaccttctgttaaa
aaggagcttcaatctgcggaatccattcaaaacaagatttcgagttcattaaagaaaagc
tttaaaaagaaagaaaaaacgacttttctgattaaatttaaagatctggctaacccagaa
aaagcggcaaaagcggctgttaaaaaagcgaaatcgaagaagctgtctgccgctaagacg
gaatatcaaaagcgttctgctgttgtgtcatctttaaaagtcacagccgatgaatcccag
caagatgtcctaaaatacttgaacacccagaaagataaaggaaatgcagaccaaattcat
tcttattatgtggtgaacgggattgctgttcatgcctcaaaagaggttatggaaaaagtg
gtgcagtttcccgaagtggaaaaggtgcttcctaatgagaaacggcagctttttaagtca
tcctccccatttaatatgaaaaaagcacagaaagctattaaagcaactgacggtgtggaa
tggaatgtagaccaaatcgatgccccaaaagcttgggcacttggatatgatggaactggc
acggttgttgcgtccattgataccggggtggaatggaatcatccggcattaaaagagaaa
tatcgcggatataatccggaaaatcctaatgagcctgaaaatgaaatgaactggtatgat
gccgtagcaggcgaggcaagcccttatgatgatttggctcatggaacccacgtgacaggc
acgatggtgggctctgaacctgatggaacaaatcaaatcggtgtagcacctggcgcaaaa
tggattgctgttaaagcgttctctgaagatggcggcactgatgctgacattttggaagct
ggtgaatgggttttagcaccaaaggacgcggaaggaaatccccacccggaaatggctcct
gatgttgtcaataactcatggggagggggctctggacttgatgaatggtacagagacatg
gtcaatgcctggcgtgcggccgatattttccctgagttttcagcggggaatacggatctc
tttattcccggcgggcctggttctatcgcaaatccggcaaactatccagaatcgtttgca
actggagcgactgatatcaataaaaagctcgctgacttttctcttcaagggccatctcca
tatgatgaaataaagccggaaatatctgcaccgggcgttaatattcgttcatccgttccc
ggtcagacatatgaggatggttgggacggcacatcaatggcagggccgcatgtatccgct
gttgctgcactgctgaaacaggcgaatgcctcactttctgttgatgagatggaggatata
ttaaccagcacggctgaaccgctcacggattcaacatttcctgattcaccgaataacgga
tatggccatggtctggtgaatgcttttgatgctgtatccgctgttacagatggattaggg
aaagcggaaggacaagtttctgtagagggggatgaccaagagcctcctgtctatcagcat
gagaaagtaactgaagcttatgaaggtggcagcctaccactgactttgacagctgaagac
aatgtgagtgtgacatctgtaaagctgtcctacaagcttgatcaaggtgaatggacagaa
ataacggctaaacgaatcagcggtgatcatctaaaaggaacgtatcaggcagagatccca
gatataaaaggaactaaactaagctataagtggatgattcacgattttggcggtcatgtc
gtttcgtctgacgtatacgatgtaacagtgaaaccaagcatcacggcgggatataagcag
gactttgaaactgcacccggcggctgggttgcgagcggaacaaataataactgggaatgg
ggagttccgtcaactggcccaaatacagcagcatccggagaaaaagtatatggaacgaat
ttgacaggaaattatgccaactcagcaaacatgaaccttgttatgcctcctattaaagca
cctgattcaggaagtctgttccttcaatttaaaagctggcacaatttagaggatgatttt
gattacggctacgtttttgttcttccggaaggtgaaaagaattgggagcaggctggtgtc
tataacggaaagacatcaagctggacggacgaagaaattgatttatcggcttataaaggc
caaaacattcaagtgatgtttaaccttcaatctgatgaaagcattgcaaaagagggctgg
tatattgatgatgtagtgctttctgacaaatcagccggaaaaacagtcaaaaagaataag
ctgggcgtcgaaaagccgtctggaaagcaaaagaaaaagccagtaaatccgaaaaaggct
aagccatctgcaaacacagcggtaaaacatcagaacaaggctatacagcctcaagttttg
ccgctcaaggcacaagtcagtgtagtggaaacaggaaaatcaacatattcagatcaatcc
acagggcagtacacgctgaagcacaaagcgggagactatacgcttatggcagaagcatat
ggttatcagtcgaaaacacaaaaagtatctttaaagacggatcagacgacacaagctaat
tttacgttagaagagatgaagaagggcacattaaaaggcacggtcatcaataaaacgaca
ggagagccggtaacaggcgcttccgtttatgttgtagaggatgctgcggtggaaccggct
atgacaaacgacaaaggtgaatatatgctggaggcctatgaaggcgcttatacgattaaa
gtcgctgcaccgggttattacagtgatgaattttccgttgagttaaaaggtgatgttaca
aaagaaactgcattgaagcctttcgtcggttatccgggtgaaattgcatatgatgacgga
acagcggagaatgccaattcctattttgctgccggtaacggatgggcggtaaaaatgacg
ctcgctgacggcaaggacaaaggcatgcttacaggagggctgttcagattctgggataca
gagttccctgatccgggcggcacagagtttaaggttgaggtatacgatgccacaggaaaa
gacggagcaccgggcaagaaaattgcagggccatttaacgcggaagctcttcgcaatggc
gagtggactaaggtagatctcagttcaaaagggattatggtcgataaagatttttatctc
gtatatatccagtcgaaacctgatccgtattcacctggattggcaatggatgaaaccggc
cagaattccggccgcaactggcagtatatagatggaaagtggcagccaggtgacaaagcg
gatggcaactatatgattcgcgcattagttgattatgaagctgctgtacctgagattact
tcaccgacagacaaatcatacacaaataaggatagcgtcactgtaaaaggaaacgcttct
cctggcacaacggtacacatttataatggagagaaagaagcaggagaaacgaaagctgct
gcggatggcacgttccatgcaggcatcatactcaacaagggtgaaaatgagctgacggca
actgcatcaactgacaacggaacaacagatgcctccagcccaatcacggtcacgcttgat
caagaaaagcctgaattaacactggacaatccaaaggatggcgggaaaacaaataaagaa
acgctgactgtcaaaggggctgtatccgatgacaatctgaaagacgtcaaggtgaatggc
aaaaaagcaacagtagctgatggttcatactcagcccgtattcttttggaaaatggaaga
aatgaaatcaaggtaattgctacagacttggcaggcaacaaaacgacgaaaaagacagtc
attgatgtgaactttgacaagcctgtcatttccggcttaattccgggagaggataaaaac
ttaaaagccggtgaatctgtgaaaatcgctttctcaagcgctgaggatttagatgcaacg
tttaccattcgtatgccgctgaccaatgcaagagcgagtgtgcaaaatgccaccgaactc
ccgttaagagaaatctctccggggagatatgaaggctattggactgccacttcttctatt
aaagcaaaaggagcaaaagtagaagtgatcgtccgagatgattatggaaatgaaacaaga
aaaactgcgaatggaaaacttaatatgaacacagaaaattaa

DBGET integrated database retrieval system