KEGG   Bacillus subtilis subsp. subtilis 168: BSU15320
Entry
BSU15320          CDS       T00010                                 

Symbol
sigE
Name
(RefSeq) RNA polymerase sigma-E factor
  KO
K03091  RNA polymerase sporulation-specific sigma factor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU15320 (sigE)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU15320 (sigE)
SSDB
Motif
Pfam: Sigma70_r2 Sigma70_r4 HTH_3 Sigma70_r4_2 HTH_31 HTH_37 Trp_repressor KORA HTH_23 MarR_2 Phage_CII HNF-1_N FAM76 HTH_19 GerE
Other DBs
NCBI-GeneID: 939683
NCBI-ProteinID: NP_389415
Pasteur: BG10235
BSORF: BG10235
UniProt: P06222 A0A6M3ZAY0
Position
1604771..1605490
AA seq 239 aa
MKKLKLRLTHLWYKLLMKLGLKSDEVYYIGGSEALPPPLSKDEEQVLLMKLPNGDQAARA
ILIERNLRLVVYIARKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIKLATYASRCIEN
EILMYLRRNNKIRSEVSFDEPLNIDWDGNELLLSDVLGTDDDIITKDIEANVDKKLLKKA
LEQLNEREKQIMELRFGLVGEEEKTQKDVADMMGISQSYISRLEKRIIKRLRKEFNKMV
NT seq 720 nt   +upstreamnt  +downstreamnt
atgaaaaaactgaaattacggttgacgcacctctggtataagctgctgatgaaacttggg
ctgaaaagtgatgaagtctattacataggcgggagtgaagccctgccgcctccattatct
aaagatgaggagcaggttttgttaatgaagctcccaaacggcgatcaggcggcgcgcgcc
attctaattgaacgcaatttgcgtctggtcgtatatatcgcccgtaaatttgaaaatacg
ggaattaatatagaggatttaatcagcatcggtaccatcggtctaatcaaagctgttaat
acatttaatccagaaaagaaaatcaagcttgctacctatgcctcccggtgtatagaaaat
gaaatcctgatgtatttaagaagaaataacaaaatccgttcagaggtttcctttgatgaa
ccgcttaatattgattgggacggcaatgagcttttgctttctgatgtgctcggcactgac
gatgacatcatcactaaagacatagaagctaacgtcgataaaaagcttttgaaaaaagcg
cttgaacagcttaatgagagagaaaagcaaatcatggagctgcggtttgggcttgtcggt
gaagaagaaaaaacccaaaaggatgtagcggatatgatggggatttctcagtcttatatt
tcgcggcttgagaaaagaattataaaaaggttgagaaaagagttcaacaaaatggtgtaa

DBGET integrated database retrieval system