KEGG   Bacillus subtilis subsp. subtilis 168: BSU15330
Entry
BSU15330          CDS       T00010                                 

Symbol
sigG
Name
(RefSeq) RNA polymerase sigma-G factor
  KO
K03091  RNA polymerase sporulation-specific sigma factor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU15330 (sigG)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU15330 (sigG)
SSDB
Motif
Pfam: Sigma70_r2 Sigma70_r4 Sigma70_r3 HTH_3 Sigma70_r4_2 KORA HTH_31 Sigma70_ECF HTH_28 HTH_23 Trp_repressor HTH_37 GerE SieB HTH_26 HTH_25
Other DBs
NCBI-GeneID: 939953
NCBI-ProteinID: NP_389416
Pasteur: BG10236
BSORF: BG10236
UniProt: P19940 A0A6M4JG58
Position
1605630..1606412
AA seq 260 aa
MSRNKVEICGVDTSKLPVLKNEEMRKLFRQLQDEGDDSAREKLVNGNLRLVLSVIQRFNN
RGEYVDDLFQVGCIGLMKSIDNFDLSHNVKFSTYAVPMIIGEIRRYLRDNNPIRVSRSLR
DIAYKALQVRERLISETSKEPTAEDIAKVLEVPHEEIVFALDAIQDPVSLFEPIYNDGGD
PIYVMDQISDERNTDSQWIEELALKEGMRRLNDREKMILRKRFFQGKTQMEVAEEIGISQ
AQVSRLEKAAIKQMNKNIHQ
NT seq 783 nt   +upstreamnt  +downstreamnt
gtgtcgagaaataaagtcgaaatctgcggggtggatacctccaaattaccagtactcaag
aatgaagagatgagaaagctgtttaggcagctgcaggatgaaggcgatgattcagcaaga
gaaaagcttgtaaacgggaacttgcgtcttgtcttaagtgtcattcaacgatttaataac
agaggggagtatgttgatgacttatttcaagtcggctgcatcggactaatgaaatccatt
gataattttgacctaagccacaatgttaagttttcaacatacgctgtacctatgattatc
ggagagatccgcaggtatttacgtgataataacccgatccgtgtctcaagatcactccgg
gacatcgcttacaaggcgcttcaggtaagagagcggttaatcagtgagacaagcaaggag
ccgactgcagaagacatcgcaaaagttcttgaagtaccgcatgaggaaattgtatttgcg
cttgatgccattcaggatccggtttctctatttgaaccgatctataacgacggcggagac
ccgatctatgtgatggaccaaatcagtgatgagcgtaatacagattcacaatggattgaa
gagctggctttaaaagagggcatgagaaggctgaacgatagggaaaaaatgattttgaga
aagcgattcttccaagggaaaacccaaatggaagtcgccgaggaaatcggaatttctcaa
gcgcaggtgtccagacttgaaaaagcggctatcaaacaaatgaataaaaatattcatcaa
taa

DBGET integrated database retrieval system