KEGG   Bacillus subtilis subsp. subtilis 168: BSU16000
Entry
BSU16000          CDS       T00010                                 

Symbol
ylqC
Name
(RefSeq) hypothetical protein
  KO
K06960  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU16000 (ylqC)
SSDB
Motif
Pfam: KH_4 KH_2 KH_1 Zw10
Other DBs
NCBI-GeneID: 936821
NCBI-ProteinID: NP_389482
Pasteur: BG13402
BSORF: BG13402
UniProt: O31738 A0A6M4JGN3
Position
1673892..1674137
AA seq 81 aa
MTDQHLEDLIVHIVTPLVDHPDDIRVIREETDQKIALRLSVHKSDTGKVIGKQGRTAKAI
RTAVFAAGVQSSKKVQFEIFD
NT seq 246 nt   +upstreamnt  +downstreamnt
atgactgatcaacacttggaagatttgattgtccacattgtgacgccgcttgttgatcat
ccagatgacattcgcgtcataagagaagaaaccgatcaaaagattgcgctgcgcttatct
gtccataagtcagataccggtaaagttatcggaaagcaaggccggactgcaaaagcgatt
cgaacagctgtatttgcagctggcgtacagtcttctaagaaagttcaatttgaaatattt
gactaa

DBGET integrated database retrieval system