KEGG   Bacillus subtilis subsp. subtilis 168: BSU16110
Entry
BSU16110          CDS       T00010                                 

Gene name
dprA
Definition
(RefSeq) protein smf
  KO
K04096  DNA processing protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    BSU16110 (dprA)
Motif
Pfam: DNA_processg_A LDcluster4 STALD
Other DBs
NCBI-GeneID: 940135
NCBI-ProteinID: NP_389493
Pasteur: BG11006
BSORF: BG11006
UniProt: P39813 A0A6M4JMY4
Position
1682580..1683473
AA seq 297 aa
MDQAAVCLTICRINQLLSPSLLLKWWKADPSMSLTSPVLQTVTRDQIKAAALKNEIEQFY
PKLPRVLAAYREQGINTIPISSKQYPFWLKSIYDPPAVLFAKGDMTLLSKGRKIGIVGTR
NPTAYGKQVVNHLTKEICRKGWVIVSGLASGIDGMSHAASIKAKGRTIGVIAGGFQHIYP
RENLQLADHMAKHHILLSEHPPETKPQKWHFPMRNRIISGLSEGVIVVQGKEKSGSLITA
YQALEQGREVFAVPGSLFDPYAGGPIKLIQQGAKAIWSAEDIFEELPERNVQYTEPF
NT seq 894 nt   +upstreamnt  +downstreamnt
ttggatcaggccgctgtctgcctaacgatttgcagaatcaatcaattattatccccatcc
cttctattaaaatggtggaaagccgatccgtctatgtcgctgacatcacccgtgttacaa
acggttactcgtgatcaaataaaagcagctgcattaaaaaacgaaatagaacaattttat
ccaaagctcccgcgtgtacttgctgcttatcgtgagcaaggcattaacaccatccctatt
tcttcaaagcaatatcctttctggcttaaaagcatttatgatccccctgccgtactgttt
gcaaaaggtgatatgactcttctttcgaaagggagaaaaattggaattgtaggcacaaga
aatccaacagcttatgggaaacaagttgtcaatcatcttacaaaagagatctgtcgtaaa
ggttgggtgattgtcagcggactggcgtctgggatagacggaatgtcccatgctgcaagt
attaaggcgaaggggcggacaattggcgtcattgcaggcggatttcaacacatttatccc
cgagaaaaccttcagttagcagatcacatggctaaacaccatatcctgctgtcagagcac
ccacctgaaactaaaccccaaaaatggcatttccctatgagaaaccgtattatcagcgga
ctaagtgaaggcgttattgtcgttcagggcaaagaaaaaagcggttcgctgattactgcc
tatcaagcattggaacaagggagagaggtatttgccgtacccggttcattgtttgaccct
tacgccggaggtcctataaaactgatccagcagggggctaaagccatatggtcagcagag
gatattttcgaggaacttcctgagagaaacgttcaatatacggaacccttttga

DBGET integrated database retrieval system