KEGG   Bacillus subtilis subsp. subtilis 168: BSU16160
Entry
BSU16160          CDS       T00010                                 

Symbol
hslU
Name
(RefSeq) ATP-dependent protease ATPase subunit ClpY
  KO
K03667  ATP-dependent HslUV protease ATP-binding subunit HslU
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU16160 (hslU)
Chaperones and folding catalysts [BR:bsu03110]
 Heat shock proteins
  HSP100
   BSU16160 (hslU)
SSDB
Motif
Pfam: AAA_2 AAA ClpB_D2-small AAA_5 MCM RuvB_N AAA_22 Mg_chelatase Sigma54_activat AAA_16 TIP49 AAA_18 Zeta_toxin IstB_IS21 IPT TniB AAA_33 AAA_28 GTA_TIM ABC_tran AAA_7
Other DBs
NCBI-GeneID: 936301
NCBI-ProteinID: NP_389498
Pasteur: BG10967
BSORF: BG10967
UniProt: P39778 A0A6M3ZAR6
Position
1688676..1690079
AA seq 467 aa
MEKKPLTPRQIVDRLDQYIVGQQNAKKAVAVALRNRYRRSLLDEKLKDEVVPKNILMMGP
TGVGKTEIARRIAKLSGAPFIKIEATKFTEVGYVGRDVESMVRDLVETSVRLIKEEKMNE
VKEQAEENANKRIVRLLVPGKKKQSGVKNPFEMFFGGSQPNGEDEAESQEEANIEEKRKR
MAHQLALGELEDYYVTVEVEEQQPSMFDMLQGSGMEQMGMNMQDALSGLMPKKKKRRKMT
VREARKVLTNEEASKLIDMDEVGQEAVQRAEESGIIFIDEIDKIAKNGGASSSADVSREG
VQRDILPIVEGSTVVTKYGSVKTDHVLFIAAGAFHMAKPSDLIPELQGRFPIRVELNKLT
VDDFVRILVEPDNALLKQYQALLQTEGISLEFSDEAIHKIAEVAYHVNQDTDNIGARRLH
TILERLLEDLSFEAPDVTMEKITITPQYVEEKLGTIAKNKDLSQFIL
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggaaaaaaaaccgttaactcctagacagattgtagatcggttagaccaatatattgtc
ggtcagcaaaatgcgaaaaaagctgtcgccgtggcattaagaaaccgctatagaagaagt
cttctggatgaaaagctgaaggacgaggtcgttccgaaaaacattttaatgatgggtcct
accggcgtcgggaaaactgaaattgccagacgaatcgctaagctttcaggtgcgccattt
atcaaaattgaagctactaaatttaccgaagtcggctatgtaggcagagatgttgaatca
atggtcagagatcttgtggagacttctgttcggcttataaaagaagagaaaatgaatgaa
gtaaaggaacaggcagaagaaaatgcaaacaaacgcattgttcgtctgttagttcctggg
aagaaaaaacaatctggtgttaaaaatccgtttgaaatgttttttggaggcagccagccg
aatggtgaagatgaggcggagagccaggaagaagcaaacatcgaagaaaaaagaaaacga
atggcgcatcagctggctttaggagagctcgaagactactatgtaacagtagaagtcgaa
gaacagcagccttctatgtttgacatgctgcagggctcgggtatggagcagatgggtatg
aacatgcaggatgcgctgagcggattaatgccaaagaaaaagaagcggcgcaaaatgaca
gtcagagaagccagaaaagtcctgacgaatgaagaagcaagcaaactcatcgatatggat
gaagtcggccaggaagctgttcagagagcagaagagagcgggattatctttatcgatgag
attgataaaatcgcaaagaacggcggtgcatcttcttctgccgatgtttcaagagaaggt
gttcagcgggatatccttccgattgttgaaggttctaccgttgtcacaaaatatggttct
gtaaaaacagaccatgtattatttattgcagcaggagcgtttcatatggccaaaccgtct
gatttgattcctgagctgcaggggcgtttcccgattcgtgtagaactgaacaaactcacg
gtagacgacttcgtgagaattttggttgagccggataatgcgctgctgaaacaatatcag
gcattattgcagacagaaggtatatctcttgaattttctgacgaagctattcataagatt
gctgaagttgcttatcatgtgaaccaggacacagataatatcggtgcgagacgccttcat
acaatacttgaacgcctattagaagatttgtcgtttgaagctccagatgtaacgatggag
aaaataacgattacaccacagtatgtcgaagaaaagctcggaacgatagccaaaaacaaa
gatttaagtcaatttatattgtga

DBGET integrated database retrieval system