KEGG   Bacillus subtilis subsp. subtilis 168: BSU16410
Entry
BSU16410          CDS       T00010                                 

Symbol
ylxH
Name
(RefSeq) flagellum site-determining protein YlxH
  KO
K04562  flagellar biosynthesis protein FlhG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16410 (ylxH)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Others
    BSU16410 (ylxH)
SSDB
Motif
Pfam: ParA AAA_31 CbiA Fer4_NifH CBP_BcsQ ArsA_ATPase MipZ VirC1 AAA_25 AAA_24 CLP1_P MeaB Zeta_toxin
Other DBs
NCBI-GeneID: 940123
NCBI-ProteinID: NP_389523
Pasteur: BG10254
BSORF: BG10254
UniProt: P40742 A0A6M4JLX9
Structure
PDB: 
3SYN

Position
1710838..1711734
AA seq 298 aa
MQMNRYDQAATLRAKMEKRERVLPMVYSQKAKTLAVISGKGGVGKSNITLNMALALQDKG
KKVLLIDLDIGMGNIDILIGNSSSATIIDVLTDRKPLLQSLSVGPKGLRYISGGTGLDVM
FQLDQRKWTFFANELSHALSQFDYVLFDMGAGLSKDQLPFILSAEDILIITTPEPTAIMD
AYSAVKHLVLTENKLSMKVAVNRCRDQKEGLDAFARLSRTIHMFLDVQVQFAGSVSDDVI
VSKAVVEQVPFFIKSPQAKASRSVRILADALFEREETRHKEDKQTFIEKLSSFLMRRA
NT seq 897 nt   +upstreamnt  +downstreamnt
gtgcagatgaacagatatgaccaagcagcaactttacgggcgaaaatggaaaaacgtgag
cgcgttctgccaatggtttattcacaaaaagcgaagacacttgctgtcatcagcggcaag
ggcggtgtcggaaaatccaatattaccttaaatatggcacttgcgctgcaggataaaggt
aagaaggtgctgctcatcgaccttgatatcgggatggggaacattgatatattaatagga
aattcatcgtctgccacgataatcgatgttttaaccgatcgtaagcctttgctgcagtca
ttatccgttggcccaaagggtttgcggtatatatcagggggaaccggtcttgatgtgatg
tttcagctcgatcagagaaaatggacgttttttgccaatgaactttctcatgcattaagc
cagttcgattatgtgctgtttgacatgggagcaggcttatcaaaagatcaactgcctttt
attttatcagcagaagatattttgattattacaactcccgagccgacggccattatggac
gcatacagcgctgtcaagcacttggttttgacagaaaataagctttcaatgaaggtggct
gtcaatcggtgccgtgaccaaaaggaagggcttgacgcttttgcccgcctctcccgtaca
attcatatgtttttggatgttcaggttcagtttgccggttccgtttctgacgatgtgatc
gtgagcaaagcggttgtcgaacaggttccttttttcataaaaagccctcaggcaaaagcc
agccggtcagtccgtattttagcggacgccttgtttgaaagagaagaaacgagacacaaa
gaagacaaacagacatttattgagaaattatcttcttttttaatgaggagggcttaa

DBGET integrated database retrieval system