KEGG   Bacillus subtilis subsp. subtilis 168: BSU16600Help
Entry
BSU16600          CDS       T00010                                 

Gene name
nusA
Definition
(RefSeq) transcription termination/antitermination protein NusA
  KO
K02600  transcription termination/antitermination protein NusA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU16600 (nusA)
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU16600 (nusA)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BSU16600 (nusA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic Type
  rRNA transcription factors
   BSU16600 (nusA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NusA_N KH_5 S1 KH_2 KH_1 tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 939628
NCBI-ProteinID: NP_389542
Pasteur: BG10265
BSORF: BG10265
UniProt: P32727
Structure
PDB: 

Position
1732281..1733396
Genome map
AA seq 371 aa AA seqDB search
MSSELLDALTILEKEKGISKEIIIEAIEAALISAYKRNFNQAQNVRVDLNRETGSIRVFA
RKDVVDEVYDQRLEISIEEAQGIHPEYMVGDVVEIEVTPKDFGRIAAQTAKQVVTQRVRE
AERGVIYSEFIDREEDIMTGIVQRLDNKFIYVSLGKIEALLPVNEQMPNESYKPHDRIKV
YITKVEKTTKGPQIYVSRTHPGLLKRLFEIEVPEIYDGTVELKSVAREAGDRSKISVRTD
DPDVDPVGSCVGPKGQRVQAIVNELKGEKIDIVNWSSDPVEFVANALSPSKVLDVIVNEE
EKATTVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSETDARELGIYPRELEEDDEPL
FTEPETAESDE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgaattattagatgctctcacgattcttgaaaaagaaaaaggcatcagtaaa
gaaattatcatcgaagcaatcgaagctgcgttaatttctgcttataagcggaattttaat
caagcgcaaaatgtacgggtggatctaaaccgtgaaactggctccatccgtgtatttgca
agaaaagatgtcgttgacgaagtatacgaccagagattagaaatctcaattgaagaggca
cagggcatccatccggaatatatggtcggcgatgtcgtcgaaatcgaagttacacctaag
gatttcgggcgcatagctgctcaaacagcgaagcaggtcgtcacacagcgtgtgcgcgaa
gctgagcgcggtgtgatttattctgaatttatcgaccgtgaagaagacatcatgacaggg
atcgtccagcgtctggacaataaatttatctacgtgtctttaggcaaaatagaagccttg
ctgccggttaatgagcaaatgccgaatgaaagctacaagccccatgaccgcattaaggta
tatatcacaaaagtagaaaaaacaacgaagggtccgcagatttatgtgtcaagaacacat
ccaggcctgttaaagcgtttgtttgaaattgaagtgcctgaaatttatgatggaactgtc
gagctaaaatctgttgccagagaagccggcgaccgttcgaaaatttctgttcgcacagat
gatcctgacgttgatcctgtcggttcatgcgtagggcctaaaggccagcgtgtgcaagca
atcgtcaatgaattaaaaggtgaaaaaattgacattgtcaactggtccagtgatcctgta
gaatttgtcgcgaatgcgctcagcccttccaaagtgcttgatgtcattgttaatgaagaa
gaaaaagcgacaactgttattgttcctgattaccagctgtctctggcaattggaaaaaga
ggacaaaacgcacgcttagctgctaaactgacaggctggaagattgatattaagagcgaa
acggacgcaagagaacttggaatctatccgagagaacttgaagaagatgatgagccgctc
tttacggagcctgaaactgctgaatcggatgaataa

DBGET integrated database retrieval system