KEGG   Bacillus subtilis subsp. subtilis 168: BSU16660
Entry
BSU16660          CDS       T00010                                 

Gene name
truB
Definition
(RefSeq) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU16660 (truB)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     BSU16660 (truB)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    BSU16660 (truB)
 Prokaryotic type
    BSU16660 (truB)
Motif
Pfam: TruB_N TruB_C_2 PseudoU_synth_2
Other DBs
NCBI-GeneID: 939638
NCBI-ProteinID: NP_389548
Pasteur: BG10271
BSORF: BG10271
UniProt: P32732 A0A6M3ZAX8
Position
1736886..1737815
AA seq 309 aa
MVNGVLLLHKPVGMTSHDCVMKIRKLLKTKKVGHTGTLDPEVSGVLPICVGRATKIVEYL
TEKSKTYDAEITLGFSTTTEDQTGETVETKPVNHDIDKADVEKVLNSLKGKQEQIPPMYS
AVKVNGKKLYEYARAGIEVERPKRMITIEDIALTTEIKHHGETASFRFTVTCSKGTYVRT
LAVMIGEKLGYPAHMSHLIRTASGDFSLDECFTFDELEAQAQSGTVEEHTVPIERALNHL
PKWIISDTLAKKVENGALLETPEQFSEMTSGDRIAVFTESGTCLAIYFPHPAKKGLLKPA
KVLMQKSEQ
NT seq 930 nt   +upstreamnt  +downstreamnt
atggttaacggagttctccttttacataaacctgttggcatgacatcgcacgactgtgtc
atgaagatccgaaagctgttaaaaacaaaaaaagtaggacatacaggaacgctcgatccg
gaagtatcaggcgtgcttccgatttgtgtaggaagagcgacaaaaatagtcgaatactta
actgaaaaatctaaaacgtatgatgcagaaataacattgggcttttcaaccacaacagag
gatcaaaccggagaaacggtggaaacaaagcctgtcaatcacgacattgataaagcggat
gtagaaaaggttttaaacagtttaaaggggaaacaagaacaaattccgcccatgtattcc
gctgtaaaagtaaacggcaaaaaattatacgaatacgcaagagcagggattgaagtagaa
cgtccgaaacgtatgataaccattgaagacattgccctgacaacagagattaaacatcat
ggagaaaccgcaagcttccggtttacagtgacttgctccaaagggacctatgtaaggacg
ctggcggtcatgatcggagaaaagctcggatatccggcccatatgtctcatttaatccgt
acggcatccggagatttttctctcgacgaatgctttacttttgatgaactcgaagcacag
gcccaatccggaaccgtggaagagcatacagttcctattgaacgtgcgctcaatcatttg
ccgaaatggatcataagtgatacattagctaagaaagtagaaaatggggctttgcttgag
acgcccgagcagttttctgaaatgacaagtggagaccgtattgccgtctttactgaatcc
ggaacctgcttggcgatctatttccctcatcctgcaaaaaaagggctgttaaagccggca
aaagtattgatgcaaaaaagcgaacaatag

DBGET integrated database retrieval system