KEGG   Bacillus subtilis subsp. subtilis 168: BSU16690
Entry
BSU16690          CDS       T00010                                 

Gene name
pnpA
Definition
(RefSeq) polyribonucleotide nucleotidyltransferase
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU16690 (pnpA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU16690 (pnpA)
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU16690 (pnpA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     BSU16690 (pnpA)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BSU16690 (pnpA)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA degradation factors
   BSU16690 (pnpA)
SSDB
Motif
Pfam: RNase_PH RNase_PH_C PNPase S1 KH_1 SPATA25
Other DBs
NCBI-GeneID: 939646
NCBI-ProteinID: NP_389551
Pasteur: BG11491
BSORF: BG11491
UniProt: P50849
Position
1739383..1741500
AA seq 705 aa
MGQEKHVFTIDWAGRTLTVETGQLAKQANGAVMIRYGDTAVLSTATASKEPKPLDFFPLT
VNYEERLYAVGKIPGGFIKREGRPSEKAVLASRLIDRPIRPLFADGFRNEVQVISIVMSV
DQNCSSEMAAMFGSSLALSVSDIPFEGPIAGVTVGRIDDQFIINPTVDQLEKSDINLVVA
GTKDAINMVEAGADEVPEEIMLEAIMFGHEEIKRLIAFQEEIVAAVGKEKSEIKLFEIDE
ELNEKVKALAEEDLLKAIQVHEKHAREDAINEVKNAVVAKFEDEEHDEDTIKQVKQILSK
LVKNEVRRLITEEKVRPDGRGVDQIRPLSSEVGLLPRTHGSGLFTRGQTQALSVCTLGAL
GDVQILDGLGVEESKRFMHHYNFPQFSVGETGPMRGPGRREIGHGALGERALEPVIPSEK
DFPYTVRLVSEVLESNGSTSQASICASTLAMMDAGVPIKAPVAGIAMGLVKSGEHYTVLT
DIQGMEDALGDMDFKVAGTEKGVTALQMDIKIEGLSREILEEALQQAKKGRMEILNSMLA
TLSESRKELSRYAPKILTMTINPDKIRDVIGPSGKQINKIIEETGVKIDIEQDGTIFISS
TDESGNQKAKKIIEDLVREVEVGQLYLGKVKRIEKFGAFVEIFSGKDGLVHISELALERV
GKVEDVVKIGDEILVKVTEIDKQGRVNLSRKAVLREEKEKEEQQS
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgggacaagaaaaacatgtctttaccatagattgggccggaagaacgcttaccgttgaa
accggccagcttgccaaacaggcaaatggtgctgtgatgatccgctacggtgatacagca
gtacttagtacagcaaccgcttcaaaagaacctaaaccgcttgatttcttccctcttact
gtaaactatgaagaaagattatatgcggtagggaaaattccgggcggatttattaaaaga
gaaggacgtccaagtgaaaaagcggttcttgccagccgtttaattgaccgtccgatccgt
cctttgtttgccgatggattccgtaatgaagttcaagtcatcagcattgtcatgagtgtt
gaccaaaactgctcttcagaaatggctgccatgttcggttcatctcttgcactttctgta
tcggatattccgtttgaaggaccgattgcaggggttactgtcggacgcattgatgatcaa
tttatcattaacccgacagtcgatcagcttgaaaaaagcgatatcaatcttgtcgttgcc
ggcacgaaagatgcgattaacatggtagaagcgggagcggacgaagttcctgaggaaatc
atgcttgaggccattatgttcggccatgaagagattaaacgcctgattgcattccaagaa
gaaattgttgcagcagtcggcaaagagaaatctgaaattaagctctttgaaattgatgaa
gagcttaatgaaaaagtaaaagctttggcagaagaggatctgctgaaagccatccaagtt
catgaaaagcatgcccgtgaagatgccattaacgaagtgaagaacgcagttgtggcaaaa
ttcgaggatgaagaacatgatgaagacacaatcaagcaagtgaagcagattttatccaag
cttgtgaaaaatgaagttcgccgcctgattactgaagagaaagtaagaccggacggccgc
ggtgtcgatcaaatccgtccgctctcttcagaggttggcctcttgccaagaacgcacggt
tcaggtctatttacaaggggacaaactcaggccctcagcgtatgtacgctaggtgctctg
ggagatgtgcaaatccttgacggcttaggtgtcgaagagtcgaaacggtttatgcatcat
tacaacttcccgcaattcagcgttggggaaacaggaccgatgcgcggaccgggacgtcgt
gaaatcggacacggagcactgggtgagcgtgcgcttgagccagttattccgtctgaaaaa
gacttcccttatactgtccgtcttgtttcagaagtgcttgaatcaaacggttctacatct
caagcaagcatttgcgcaagcacacttgcaatgatggatgccggtgtaccgattaaagcg
ccagttgctggtattgcgatgggtcttgtcaaatcaggcgaacattacactgtcttgact
gacatccaaggcatggaagacgcgctcggagatatggactttaaagtagcgggaactgaa
aaaggcgtaacggccctgcaaatggacattaaaattgaaggcctttccagagagattctt
gaagaagcgcttcagcaggcgaaaaagggcagaatggaaatcctcaacagcatgcttgca
acattaagcgaatcaagaaaagagctttctcgatatgcgcctaagatcttaacaatgacc
attaatcctgataaaatccgcgatgtcatcggaccaagcgggaaacaaatcaataagatc
atcgaagaaaccggtgttaaaattgatattgagcaggacggcacaatctttatttcctct
acagatgaaagcggcaaccaaaaagcgaaaaaaatcatcgaagaccttgtgagagaggtt
gaagtcggccaactttacctaggtaaagtgaaacggattgaaaaattcggggctttcgtt
gaaattttcagcggaaaagacggtttggtgcacatttcagagcttgcgcttgaacgcgta
gggaaagttgaagatgttgtgaaaatcggagacgagattcttgtcaaagtcactgaaatt
gataaacaaggacgagtgaatttatcccgcaaagcggtgctccgtgaagagaaagaaaaa
gaagaacaacaatcttaa

DBGET integrated database retrieval system