KEGG   Bacillus subtilis subsp. subtilis 168: BSU16790
Entry
BSU16790          CDS       T00010                                 

Gene name
tepA
Definition
(RefSeq) translocation-enhancing protein TepA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CLP_protease ECH_1 Peptidase_S49 Lipoprotein_1 CLP1_P
Other DBs
NCBI-GeneID: 936370
NCBI-ProteinID: NP_389561
Pasteur: BG11055
BSORF: BG11055
UniProt: Q99171
Position
1751201..1751938
AA seq 245 aa
MDHRMENTEEERPEKNDAKDSIMNKIQQLGETTLPQLPQDTNIHCLTIIGQIEGHVQLPP
QNKTTKYEHVIPQIVAIEQNPKIEGLLIILNTVGGDVEAGLAIAEMLASLSKPTVSIVLG
GGHSIGVPIAVSCDYSYIAETATMTIHPVRLTGLVIGVPQTFEYLDKMQERVVKFVTSHS
NITEEKFKELMFSKGNLTRDIGTNVVGKDAVKYGLIDHAGGVGQAINKLNELIDEARKEE
GRMIQ
NT seq 738 nt   +upstreamnt  +downstreamnt
atggatcatcgtatggaaaacacagaagaagagcgtcctgaaaaaaatgatgcgaaggac
agcattatgaataaaatacagcagcttggtgaaacgacgcttccgcagctgccccaagat
acaaatattcattgtctgaccattatcggacaaattgaaggccatgttcagcttcctccg
caaaacaaaacaacaaaatatgaacatgtcatcccgcagattgtggcaattgaacaaaat
cccaaaattgaaggcttgctgatcatattaaatactgtcggaggagatgttgaagctggt
cttgccatagcggaaatgcttgcatctttatcgaaaccgaccgtttctatcgtgcttggc
ggggggcattcaatcggcgttccgattgctgtatcctgtgattacagctatatcgccgaa
acagcaacgatgacgattcatccagttaggctcaccgggctggtcatcggggtgccgcaa
acgtttgaatacctggataagatgcaagaaagagttgttaaatttgtgacaagccattcc
aatataaccgaagagaagtttaaagagctaatgttttcaaaaggaaacttaacacgcgat
atcggaacaaatgtagtcggtaaggatgcagttaaatacggattgatcgatcacgcaggc
ggtgtcggacaggcaatcaataaactgaatgagctcatcgatgaagcaaggaaagaagaa
ggacggatgattcaatga

DBGET integrated database retrieval system