KEGG   Bacillus subtilis subsp. subtilis 168: BSU16960
Entry
BSU16960          CDS       T00010                                 

Gene name
ymdA
Definition
(RefSeq) ribonuclease Y
  KO
K18682  ribonucrease Y [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU16960 (ymdA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU16960 (ymdA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU16960 (ymdA)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     BSU16960 (ymdA)
SSDB
Motif
Pfam: RNase_Y_N HD HDOD KH_1 KH_4 KH_2 DUF1980 Exonuc_VII_L
Other DBs
NCBI-GeneID: 939680
NCBI-ProteinID: NP_389578
Pasteur: BG13420
BSORF: BG13420
UniProt: O31774
Position
1767310..1768872
AA seq 520 aa
MTPIMMVLISILLILLGLVVGYFVRKTIAEAKIAGARGAAEQILEDAKRDAEALKKEALL
EAKDEIHKLRIDAEQEVRERRNELQKQENRLLQKEENLDRKHEGIDKREAMLEKKDHSLN
ERQQHIEEMESKVDEMIRMQQSELERISSLTRDEAKQIILERVENELSHDIAIMTKETEN
RAKEEADKKAKNILSLALQRCAADHVAETTVSVVNLPNDEMKGRIIGREGRNIRTLETLT
GIDLIIDDTPEAVILSGFDPIRRETARIALDKLVQDGRIHPARIEEMVEKSRREVDDYIR
EMGEQTTFEVGVHGLHPDLIKILGRLKFRTSYGQNVLKHSMEVAFLAGLMASELGEDAKL
AKRAGLLHDIGKAIDHEVEGSHVEIGVELATKYKEHPVVINSIASHHGDEEPTSIIAVLV
AAADALSAARPGARSETLENYIRRLEKLEEISESYEGVEKSFAIQAGREVRIMVKPDSIN
DLEAHRLARDIRKRIEDELDYPGHIKVTVIRETRAVEYAK
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgaccccaattatgatggttctcatctccattttgctgattctactcggtttagttgtt
ggctactttgttcgtaaaaccattgccgaagcgaaaattgcgggcgcacgcggtgcagcc
gagcaaattcttgaagatgcgaagcgtgatgctgaagcactgaaaaaagaagctctgctt
gaagcaaaggatgaaatccacaaacttcgaatagatgctgaacaggaagttcgtgaaaga
cgaaatgagcttcaaaaacaagaaaaccgtttactccaaaaggaggaaaaccttgatcgc
aaacatgagggaattgataaacgggaagcgatgttggagaagaaagatcattctctgaat
gaacgacaacaacatattgaagagatggaaagcaaagtggatgagatgattcgtatgcag
cagtctgagttggaacgaatttcgagtctgactcgtgacgaagcgaaacaaatcattctt
gagcgggttgaaaacgagctttcacatgacatcgccatcatgacaaaagaaactgaaaac
cgtgcgaaagaagaggcggataagaaagcgaaaaacattctttcactcgccttacagcgc
tgcgcagcggaccacgttgccgaaacaacggtatcagttgtcaatcttccaaatgatgag
atgaaaggacgtatcatcggacgggaagggcgtaacattcgtacgcttgaaacgctgaca
ggaattgacctgattattgatgatacgcctgaagctgtcattctttccggatttgatccg
atcagacgtgagacagccagaattgctcttgataaactcgttcaggatggccgtattcat
ccggcacggattgaagaaatggttgaaaaatctcgccgcgaggtcgatgactatattcgt
gagatgggtgagcaaacgacatttgaggttggcgttcatggcctccacccagatctcatc
aagatcctcggccgcttaaagttccgtacaagctacggtcaaaatgtgcttaagcattcc
atggaagtcgcattcttggccggtctaatggcatcggagcttggtgaagacgcaaagctt
gctaaacgtgcgggtcttcttcacgacatcgggaaagcaattgaccatgaagtagaagga
agccacgttgagatcggggtagagcttgcgaccaaatataaagagcacccagtcgtgatt
aacagtattgcatcacaccacggggacgaggagccgacttccattattgctgtactggta
gctgcagcagatgcgctttccgctgcaagacctggcgcaagaagtgagacgctcgagaat
tatattcgaagacttgaaaaacttgaagaaatttctgagtcctacgaaggtgttgaaaaa
tcatttgccattcaggctggacgcgaagtgcgaattatggtgaagccggattcaattaat
gatcttgaggctcatcgactggcgcgagatatccgcaagcgaattgaggacgagctcgat
tatccaggtcatattaaggtgacagtaatcagagagactcgagccgtagagtatgcaaaa
taa

DBGET integrated database retrieval system