KEGG   Bacillus subtilis subsp. subtilis 168: BSU16970
Entry
BSU16970          CDS       T00010                                 

Gene name
ymdB
Definition
(RefSeq) hypothetical protein
  KO
K09769  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU16970 (ymdB)
SSDB
Motif
Pfam: YmdB Metallophos
Other DBs
NCBI-GeneID: 939441
NCBI-ProteinID: NP_389579
Pasteur: BG13421
BSORF: BG13421
UniProt: O31775
Structure
PDB: 
4B2O

Position
1768941..1769735
AA seq 264 aa
MRILFIGDVVGSPGRDMVKEYVPKLKTKYKPHFTIINGENAAHGKGLTEKIYHSLIQSGA
DAITMGNHTWDKKEIFDFIDDVPNLVRPANFPEGTPGKGITYVKANGKELAVINLQGRTF
LPPLDDPFLKADELIAEAAKRTPYIFIDFHAEATSEKLALGWYTDGRASAVVGTHTHVQT
ADNRILPKGTAYITDVGMTGPYDGILGMDRETIIKRFKTNLPVRFTVAEGKTTLSGVVID
IDDQTKKAVKIERILINDDHMFFE
NT seq 795 nt   +upstreamnt  +downstreamnt
atgagaattttatttatcggagatgttgtcggttcaccgggccgtgacatggtcaaagaa
tatgtaccaaagctaaaaacaaaatataagcctcactttaccattattaatggtgaaaac
gccgcacatggaaaaggcctgacggaaaaaatttatcacagcttaatccagtccggcgca
gatgcaatcacaatggggaaccacacatgggacaaaaaagaaatatttgattttatagat
gacgttccgaacttggttcgcccggcaaactttcctgaaggaacaccggggaaagggatc
acatatgtgaaagcaaacggcaaagaactagcagtcattaatttgcagggacgtacgttt
ttgccgccgcttgatgacccgtttttaaaagcggatgaattgatcgcagaagctgcgaaa
agaacaccgtacatttttattgactttcatgccgaagcgacaagtgaaaagctcgcactt
ggctggtacacggatggacgggcatcggctgtagtaggaactcatacacacgtgcaaaca
gcggataaccgcattttgccgaagggaacggcatatattactgatgtgggaatgactggc
ccgtatgacggtatactggggatggacagagagacgattattaagcgattcaaaacgaac
cttccagtccggtttactgtcgctgaaggaaaaacaacgctcagcggagttgtcattgac
attgacgatcaaacgaaaaaagccgtgaaaattgagcgtattttaatcaacgatgatcac
atgttctttgaatag

DBGET integrated database retrieval system