KEGG   Bacillus subtilis subsp. subtilis 168: BSU17120
Entry
BSU17120          CDS       T00010                                 

Gene name
pksE
Definition
(RefSeq) polyketide biosynthesis protein PksE
  KO
K15329  trans-AT polyketide synthase, acyltransferase and oxidoreductase domains
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17120 (pksE)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   trans-AT PKS
    Bacillaene PksX synthase
     BSU17120 (pksE)
    Chivosazol hybrid PKS-NRPS
     BSU17120 (pksE)
    Macrolactin PKS
     BSU17120 (pksE)
    Difficidin PKS
     BSU17120 (pksE)
SSDB
Motif
Pfam: Acyl_transf_1 NMO Glu_synthase LpoB IMPDH
Other DBs
NCBI-GeneID: 939997
NCBI-ProteinID: NP_389593
Pasteur: BG12651
BSORF: BG12651
UniProt: O34787
Structure
PDB: 
5DZ7

Position
1786104..1788407
AA seq 767 aa
MITYVFPGQGSQQKGMGQGLFEQYQHLTDQADQILGYSIEKLCTEKSYLDVNHTEYTQPA
LYVVNALSYLKRVEETGRKPDFAAGHSLGEYNALMAAGAFDFETGLRLVKKRGELMGRIT
GGGMAAVIGLSKEQVTAVLEEHRLYDIDVANENTPQQIVISGPKKEIEKARAVFENTKDV
KLFHPLNVSGAFHSRYMNEAKQVFKQYIDSFQFAPLAIPVISNVYAEPYHQDRLKDTLSE
QMDNTVKWTDSIRFLMGRGEMEFAEIGPGTVLTGLIHRIKNEAEPLTYIPKKNPAISAHL
KEQRNVQAGITAESLGSAEFKQDYHLTYAYLAGGMYRGIASKEMVVKLSRAGMMGFFGTG
GLSLKEVEDAIHAIQGELGKGQAYGINLVHNMKHTESEEKMIDLLLRNQVSIVEASAFLS
VTPVLVRYRAKGVKRNQNGDVICSNRLIAKISRPEVAESFLSPAPENMLQKLLGENKITM
NEAELLRCIPMADDICVEADSGGHTDGGVAYSLMPAMTSLRDEMMKKYQYRKKIRVGAAG
GIGTPEAAMAAFMLGADFILTGSINQCTVEAATSDKVKDLLQQMNVQDTAYAPAGDMFES
GSKVQVLKKGVFFPARANKLYELYQRYGSIRELDAKMLAQLEEKYFKRSIEDIYKDIALH
YPAADIEKAEQNPKHKMALIFRWYFRYSSKLAISGSEHSKVDYQIHCGPALGAFNQWVKG
SQLENWRNRHVDEIGKKLMTETAVLLHERMQSMYQPSHETDNIKIKV
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgattacatatgtctttccagggcaaggctcccagcaaaaggggatgggacaagggcta
tttgaacagtatcagcatttgacagatcaagcagatcaaatattgggctattcaatagag
aagctatgtaccgaaaaatcatatctggatgtaaatcatactgaatacacgcagccggct
ttgtatgttgttaatgcactcagttacttgaagagagtggaggagaccggcagaaaacct
gattttgcggcaggacacagcttaggagaatacaatgcgctgatggcagccggtgcattt
gattttgaaaccggattaaggctcgtcaaaaaaagaggagaattgatgggacgaattaca
gggggcggaatggctgctgtgatcggcctgagtaaggaacaagttacagccgttttagaa
gagcaccgtctttatgacattgatgtggcaaatgaaaatacgccccagcaaattgtgatt
tctggcccgaaaaaagagattgaaaaagctcgggctgtttttgaaaacaccaaggatgta
aagctgtttcatccattaaatgtgagcggagcttttcattccagatatatgaatgaagcc
aaacaggtatttaagcaatatattgactcattccagtttgcacctttggcgatcccggtt
atctccaatgtctacgcagagccataccatcaagacagattaaaagatacattatctgaa
caaatggacaacacagtgaaatggacggacagcattcgttttctgatgggaagaggagaa
atggagtttgcagagattgggcctggaactgttttaaccggtctcattcatcggattaaa
aatgaagctgaaccattgacatatataccgaaaaagaaccccgcgatcagtgcgcatcta
aaggagcaacgcaatgttcaagccgggattacggcagaatctttaggaagtgctgaattt
aaacaagattatcatcttacatatgcttatcttgcaggaggaatgtaccgcggcattgct
tcgaaagaaatggtagtaaagctgtcaagagcgggaatgatggggttctttggcacagga
ggtctgagcctgaaagaggttgaagatgcgatccatgctatacaaggtgaattaggaaaa
ggacaagcctacggcatcaatctggtccacaatatgaaacatactgaatcagaagaaaaa
atgatcgatcttttattgaggaatcaagtgagcattgtggaggcttcagcatttttaagt
gtcactcctgtattagtaaggtatcgcgcaaaaggagtgaaacgaaatcaaaatggtgac
gttatatgctcaaatcgtctcatagcaaaaatatcacggccggaagttgcagaatcattt
ctgagtcctgcgcctgagaatatgctgcaaaagcttttaggagaaaataaaatcactatg
aacgaagctgagttgttgcggtgcattccgatggctgacgatatttgtgtagaagctgat
tcaggcggtcatacagatggcggtgtggcatacagcctgatgccggcgatgacatcttta
agagatgaaatgatgaaaaaatatcaataccggaaaaaaataagagttggtgcagctgga
ggaattggaacacctgaggcagcgatggcggcttttatgctaggggctgattttattcta
acaggctcaatcaatcaatgtacggttgaggcggcaacaagtgataaagtaaaggatttg
cttcagcagatgaatgtacaagatacagcctatgcgcctgcaggtgatatgtttgaatcg
ggcagtaaagtgcaggtgctaaagaaaggcgtgttctttcccgcacgggcaaacaagtta
tatgaactgtatcagcggtatgggtctatacgtgagctggatgcaaagatgctggcccag
cttgaggagaaatactttaaacgcagtatagaagacatatataaagatattgcattgcat
tatcccgcggcagacattgagaaggctgaacaaaacccgaagcataaaatggctttgatt
ttccgatggtacttcagatacagttcaaaattggcaatcagcggaagcgaacattcgaag
gtcgattatcaaattcactgcggtcccgcgctgggagcctttaatcaatgggttaaaggg
tcgcaattagaaaattggcgaaaccgccatgtggatgaaatcgggaaaaaattaatgaca
gaaacggcagtattgcttcatgaacggatgcaatcgatgtatcagccgtcgcatgaaaca
gacaacataaaaataaaagtttga

DBGET integrated database retrieval system