KEGG   Bacillus subtilis subsp. subtilis 168: BSU17420
Entry
BSU17420          CDS       T00010                                 

Gene name
spoVK
Definition
(RefSeq) stage V sporulation protein K
  KO
K06413  stage V sporulation protein K
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU17420 (spoVK)
SSDB
Motif
Pfam: AAA AAA_lid_6 AAA_22 RuvB_N Mg_chelatase Sigma54_activat AAA_5 DUF815 AAA_30 ADK AAA_18 Josephin Viral_helicase1 AAA_17 Torsin Acyl_transf_2 AAA_2 AAA_16 Bac_RepA_C AAA_33
Other DBs
NCBI-GeneID: 940089
NCBI-ProteinID: NP_389624
Pasteur: BG11039
BSORF: BG11039
UniProt: P27643
Position
1874203..1875171
AA seq 322 aa
MLERAVTYKNNGQINIILNGQKQVLTNAEAEAEYQAALQKNEAKHGILKEIEKEMSALVG
MEEMKRNIKEIYAWIFVNQKRAEQGLKVGKQALHMMFKGNPGTGKTTVARLIGKLFFEMN
VLSKGHLIEAERADLVGEYIGHTAQKTRDLIKKSLGGILFIDEAYSLARGGEKDFGKEAI
DTLVKHMEDKQHEFILILAGYSREMDHFLSLNPGLQSRFPISIDFPDYSVTQLMEIAKRM
IDEREYQLSQEAEWKLKDYLMTVKSTTSPIKFSNGRFVRNVIEKSIRAQAMRLLMGDQYL
KSDLMTIKSQDLSIKEEASGSA
NT seq 969 nt   +upstreamnt  +downstreamnt
atgttggagcgcgctgtgacttataaaaacaacggacagatcaacattattctgaacggg
caaaagcaggtgctgacgaatgctgaggcagaggcggaatatcaggctgcattgcaaaaa
aacgaagcaaagcacggcattttgaaggaaatcgaaaaagagatgagcgcattagttggg
atggaggaaatgaaacgcaacatcaaggaaatatacgcctggatttttgtgaaccaaaaa
cgcgcggagcaaggcttgaaggttggaaagcaagcgctgcacatgatgtttaaaggaaat
ccgggaacgggaaaaacgacggttgcacggctcatcggcaagctgttctttgaaatgaat
gtcctgtcaaaaggccacttaatagaagcggagcgggctgacctggtcggggagtatatc
ggacacaccgcccaaaagacgagagatttaatcaaaaagtcattaggtggcattttgttt
atagacgaagcctactcgctggcaagaggcggcgaaaaggactttgggaaagaagcgatc
gacacacttgtaaagcatatggaagacaaacagcatgagtttattttgatactcgccgga
tattcacgggaaatggatcattttctctcgttaaatcccggactccaatcaagatttccc
atctccattgattttccggattactctgtgacccagctcatggagattgcgaaacgaatg
atcgatgaaagggaataccagctcagtcaagaagcggaatggaaattgaaagattactta
atgacagtgaaaagcacgacaagtcccattaaattcagcaatggacgttttgtcagaaat
gtgatcgaaaaatcgatcagagcacaagccatgaggcttttaatgggagaccaatactta
aaaagcgacttgatgaccatcaaaagccaagatctttccattaaagaagaagcatctgga
tctgcatag

DBGET integrated database retrieval system